 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > PARATHYROID HORMONE (1-34), BOVINE for Sale > Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5

Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5 buy - large image1

Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5 buy - image1

Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5 buy - image2

Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5 buy - image3

Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5 buy - image4

Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5

Name: Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5
Brand: HORLDEN
SKU: pr2406181957
Price: 700 USD
Availability: InStock

TDS 2 Inquiries

Unit Price: Get Latest Price 

CAS No.:

12583-68-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

HORLDEN

Packaging:

1G/bottle

Price valid (until):

2025-06-18

Contact Supplier

 Chat Now

Xi'an Horlden Bio-Tech Co., Ltd

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Chemical,Intermediate,5-amino-1mq,SLU-PP332,Tirzepatide,Peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Shop Best price Pure Tirzepatida raw powder 5mg 10mg 15mg 30mg vials Tirzepatide CAS 2023788-19-2-Detailed Image 1

Shop Best price Pure Tirzepatida raw powder 5mg 10mg 15mg 30mg vials Tirzepatide CAS 2023788-19-2-Detailed Image 2

Product Name	Teriparatide
CAS NO.	12583-68-5
Purity	99%
Packaging	1g/bottle
MOQ	1g

Parathyroid Hormone (1-34), bovine is a potent parathyroid hormo (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels. Parathyroid Hormone (1-34), bovine can be used to study osteoporosis.

Shop Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5-Detailed Image 3

You can ask us for quotation and product information via Email, Phone, WhatsApp and other channels.

Email: rock@horlden.com
WhatsApp/ Signal: +86 18829283179

Shop Best price Pure Tirzepatida raw powder 5mg 10mg 15mg 30mg vials Tirzepatide CAS 2023788-19-2-Detailed Image 4

1.What's your payment terms?

Standard terms: T/T in advance and ··· Also L/C at sight is acceptable for large amount.

2.What's your shipping time?

We have bulk in stock, which means we can ship it to you immediately.

3.How do you ensure the quality of your products?

Strict QC with 6 steps testing from raw material purchase to finished product.

4.How do you ship the order normally?

For large qty order,ship the goods by sea. For small qty order, by air or express. We supply optional express for you, including DHL, FEDEX,UPS,TXT,EMS,and so on.

5.What's your loading port?

Usually Beijing, Shanghai, Qingdao, Tianjin, Guangzhou

ECHEMI Editorial Reference

Parathyroid hormone (PTH) is an 84 amino acid hormone involved in calcium regulation in counteraction to calcitonin. PTH regulates serum phosphate levels and vitamin D biosynthesis. N-terminal peptides of PTH are used to elicit and study a wide variety of responses in target cells.

Certificates

Basic Info

Product Name:

PARATHYROID HORMONE (1-34), BOVINE

Other Name:

ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE BOVINE;H-ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;BPTH 1-34;PTH (1-34) (BOVINE);TERIPARATIDE;PARATHYROID HORMONE (1-34), BOVINE

CAS No.:

12583-68-5

Molecular Formula:

C183H288N54O50S2

Molecular Weight:

4108.71

EC Number:

200-001-8

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Critical Temperature & Pressure:

−20°C

Seller Information

Business Type:
Trader

Main Products:
Chemical,Intermediate,5-amino-1mq,SLU-PP332,Tirzepatide,Peptide

Location:
9th Floor, Room 923, Building 3, Shiyuan Daguan, Xingtai 1st Street, Chanba Ecological District, Xi'an City, Shaanxi Province

Payment Terms:
100% TT in advance

Average lead Time:
7

Total Annual Revenue:
$2.5 million-$5 million

Total Employees:
11-50

Year of Establishment:
2015

Xi'an Horlden Bio-Tech Co., Ltd is committed to promoting health application products such as chemical daily necessities, APIs, pharmaceutical intermediates and Cosmetic raw materials.

We have established friendly business relationships with hundreds of customers from over 50 countries and regions. Our team is committed to providing customers with the highest quality products at reasonable prices and satisfactory service. For many years, our company has won the trust and favor of our customers with high-quality products, first-class services, and competitive prices.

We will create the highest quality and most stable supply channel for customers, adhering to the spirit of serving customers, relying on strong funds and good cooperation reputation in the industry, to provide customers with higher quality products and services. At the same time, we are willing to strengthen exchanges and sincere cooperation with domestic and foreign merchants to create a better future together. It is your best supplier.

Welcome to Xi'an Horlden Bio-Tech Co., Ltd!

Inquiry History

2 Inquiries

Country	Product	Purchase Quantity	Date Posted
Canada	Teriparatide	5 MG	Oct 28, 2025
United States	Parathyroid Hormone(1-34), bovine	2 KG	Oct 19, 2023

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Parathyroid Hormone(1-34), bovine	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
PARATHYROID HORMONE (1-34), BOVINE, CAS:12583-68-5	Reagent Grade/99	$20-22/KG FOB	Guangzhou Yaoguang Technology Co., Ltd.	Inquiry
PARATHYROID HORMONE (1-34)	/		Kindchem Co., Ltd	Inquiry
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price	Pharmaceutical Grade/99		Haikou Mingheng Technology Co., Ltd.	Inquiry
Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price	Pharmaceutical Grade/99		First Chems Co., LTD	Inquiry

Best price Pure Parathyroid Hormone (1-34), bovine raw powder Teriparatide CAS 12583-68-5

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches