 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > PARATHYROID HORMONE (1-34), BOVINE for Sale > Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price

Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price buy - large image1

Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image1

Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image2

Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image3

Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image4

Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price

Name: Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price
Brand: First Chems Co., LTD
SKU: pr2506181146
Price: 25 USD
Availability: InStock

GMP HALAL KOSHER ISO FDA 2 Inquiries

Unit Price: Get Latest Price 

CAS No.:

12583-68-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

qingdao

Brand:

First Chems Co., LTD

Packaging:

10mg 15mg/vial 10vials/box

Sample Available:

Yes

Price valid (until):

2025-07-18

Contact Supplier

 Chat Now

First Chems Co., LTD

Company Type:

Trader

Location:

China

Payment Terms:

TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Average Lead Time:

15 days

Qualification:

Main Products:

Titanium dioxide,npk,pvc,sles,labsa,mdi

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Description

Product Detail

Sales manager:Jenny
whatsapp：+8617331136691
Email:17331136691@163.com

- Teriparatide
- mediates bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells, and enhancing osteoblast differentiation. By regulating the adenylyl cyclase-cyclic adenosine monophosphate-protein kinase A conduction pathway, it intermittently stimulates the PHT-Ⅰ receptor on the surface of osteoblasts, bone lining cells and bone marrow stromal stem cells to promote the differentiation of osteoblasts and prolong osteogenesis. Cell lifespan; stimulates the proliferation of osteoblast cell lines through the phosphate C-cytoplasmic calcium ion-protein kinase C signaling pathway; reduces the differentiation of stromal cells into adipocyte lines by inhibiting the transactivation activity of PPARγ and increases the number of osteoblasts Increase; indirectly regulate bone growth by regulating cytokines, for example, it can induce iGF-1 to bind to osteoblasts, thereby promoting bone formation; regulate the process of bone formation through the Wnt signaling pathway, thereby increasing bone formation.
- Biological Activity
  ParathyroidHormone(1-34),bovine is a potent parathyroid hormone (PTH) receptor agonist. ParathyroidHorChemicalbookmone(1-34),bovine increases calcium and inorganic phosphate levels. ParathyroidHormone(1-34),bovine can be used to study osteoporosis.

Product Name	Teriparatide :
CAS	12583-68-5
Molecular Formula	C183H288N54O50S2
Molecular weight	4108.71
Purity	99%
Storage condition	Store at -20℃

Shop Growth Hormone-Inhibiting Hormone CAS 51110-01-1 Somatostatin with wholesale price-Detailed Image 1

Company profile

First Chems Co., LTD is an enterprise mainly in engaged in researching, producing and saling new-born API. Our company is located in Shijiazhuang city,Hebei province.
We have many years of professional experiences and a professional team of scientists and advanced equipments. Nowadays we formed a large varieties large scale, complete categories and high technology content product chain. Our quality system has been accredited by SGS and our quality center guarantees quality with full documentation control and complete facilities.
Based on the good quality, pretty competitive price and safe delivery our products are widely exported to many different countries, like Netherlands, Spain, UK, USA and so on. And our products are highly recognized by customers around the world, so we can build long-term cooperative relationship with many pharmaceutical enterprises in the world. We upload the principles of openness and transparency and dedicated to provide efficient and high quality services to every customer. We are sincerely looking forward to establishing a long-term stable and win-win business relationship with every customer.

Packing and Shipping

Our Advandage

1.High quality --Coming from good materials and high technology.
2.Lower price--Not cheapest but the lowest at the same quality.
3.Good service--Satisfactory service before and after sale.4.We have our own warehouses in Australia, the United States, Germany, Canada and other countries, which greatly saves shipping time and customers can receive their packages faster. In addition, customers can also choose door-to-door pickup service.

FAQ

Q: How to order this product?
A: You can click "contact now" , and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.
Q: How long can I receive my ordered goods?
A: We ship by express door to door; you can receive it in 7-10 days.
Q: What liquid should I add into the vial? And how much liquid needed?
A: You can add sterile water or saline, 1 vial add 1ml liquid is ok.
Q: Will I have any side effects after using peptide?
A: If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.
Q: How to store it?
A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

ECHEMI Editorial Reference

Parathyroid hormone (PTH) is an 84 amino acid hormone involved in calcium regulation in counteraction to calcitonin. PTH regulates serum phosphate levels and vitamin D biosynthesis. N-terminal peptides of PTH are used to elicit and study a wide variety of responses in target cells.

Certificates

Basic Info

Product Name:

PARATHYROID HORMONE (1-34), BOVINE

Other Name:

ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE BOVINE;H-ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;BPTH 1-34;PTH (1-34) (BOVINE);TERIPARATIDE;PARATHYROID HORMONE (1-34), BOVINE

CAS No.:

12583-68-5

Molecular Formula:

C183H288N54O50S2

Molecular Weight:

4108.71

EC Number:

200-001-8

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Critical Temperature & Pressure:

−20°C

Seller Information

Business Type:
Trader

Main Products:
Titanium dioxide,npk,pvc,sles,labsa,mdi

Location:
37 Keji Road, Yanta District, Xi 'an City, Shaanxi Province

Payment Terms:
TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
15 days

Total Annual Revenue:
$5 million-$10 million

Total Employees:
Less than 5

Year of Establishment:
2020

COMPANY OVERVIEW

First Chems Co., LTD，a joint-stock enterprise with production, export and services of chemicals, has widely adopted world-advanced equipments and management system, and our products quality is assured under the ISO9001 and ISO14001 standards, mainly specializes in developing Agriculture/Fertilizer chemicals series, Washing detergent chemicals series, Soda alkali chemicals series, Water treatment chemical series, etc.

Our main products include:

a. Agriculture/Feed chemicals series : Zinc Sulphate, Manganese sulfate etc.),

b. Washing detergent chemicals series : (LABSA, SLES, CEDA,STPP, etc.)

c. Soda alkali chemicals series : ( Caustic Soda , Sodium Sulphate Anhydrous etc.)

d. Water treatment chemical series: (Calcium hypochlorite, TCCA,SDIC, PAC- poly aluminium chloride, PFS, Aluminium sulfate etc.)

e. Adsorbent Desiccant Activated Alumina Ball

f. Raw material Calcium Aluminate ,Aluminium Hydroxide

Inquiry History

2 Inquiries

Country	Product	Purchase Quantity	Date Posted
Canada	Teriparatide	5 MG	Oct 28, 2025
United States	Parathyroid Hormone(1-34), bovine	2 KG	Oct 19, 2023

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
PARATHYROID HORMONE (1-34), BOVINE, CAS:12583-68-5	Reagent Grade/99	$20-22/KG FOB	Guangzhou Yaoguang Technology Co., Ltd.	Inquiry
Teriparatide TER10 High Quality Lyophilized Powder Customs Lyophilized Powder Peptide	Pharmaceutical Grade/99	$200/UNIT FOB	Beijing Beautide Co., Ltd	Inquiry
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price	Pharmaceutical Grade/99		Haikou Mingheng Technology Co., Ltd.	Inquiry
High quality latest batch of teriparatide TER10 CAS 12583-68-5 at favorable price	Pharmaceutical Grade/99		Jinan Pingxing Trading Co., Ltd.	Inquiry
Parathyroid Hormone(1-34), bovine	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry

Factory direct sales latest batch of teriparatide CAS 12583-68-5 at favorable price

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller