Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > PARATHYROID HORMONE (1-34), BOVINE for Sale > High quality latest batch of teriparatide CAS 12583-68-5 at favorable price
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price buy - large image1
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image1
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image2
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image3
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image4
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image5
High quality latest batch of teriparatide CAS 12583-68-5 at favorable price buy - image6

High quality latest batch of teriparatide CAS 12583-68-5 at favorable price

2 Inquiries

Unit Price: Get Latest Price
CAS No.:

12583-68-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GuangZhou

Brand:

XKY

Packaging:

10mg 15mg/vial 10vials/box

Price valid (until):

2025-08-08

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail   



    Sales manager:Mandy
    whatsapp:+86175 3199 5310
    Email:Mandy@xtmingheng.com


    Our peptide factory produces peptides of various specifications and provides COA certificates with a purity of up to 99%. If there are any quality problems after purchase, we will reissue them for free. Your trust is our greatest motivation, welcome to contact me!

    Product Name
    • Teriparatide :
    CAS  12583-68-5
    Molecular Formula C183H288N54O50S2
    Molecular weight  4108.71
    Purity     99%
    Storage condition 

    Store at -20℃

    Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 1


        • Teriparatide 
        • mediates bone metabolism by inhibiting osteoblast apoptosis, activating bone lining cells, and enhancing osteoblast differentiation. By regulating the adenylyl cyclase-cyclic adenosine monophosphate-protein kinase A conduction pathway, it intermittently stimulates the PHT-Ⅰ receptor on the surface of osteoblasts, bone lining cells and bone marrow stromal stem cells to promote the differentiation of osteoblasts and prolong osteogenesis. Cell lifespan; stimulates the proliferation of osteoblast cell lines through the phosphate C-cytoplasmic calcium ion-protein kinase C signaling pathway; reduces the differentiation of stromal cells into adipocyte lines by inhibiting the transactivation activity of PPARγ and increases the number of osteoblasts Increase; indirectly regulate bone growth by regulating cytokines, for example, it can induce iGF-1 to bind to osteoblasts, thereby promoting bone formation; regulate the process of bone formation through the Wnt signaling pathway, thereby increasing bone formation.
        • Biological Activity
          ParathyroidHormone(1-34),bovine is a potent parathyroid hormone (PTH) receptor agonist. ParathyroidHorChemicalbookmone(1-34),bovine increases calcium and inorganic phosphate levels. ParathyroidHormone(1-34),bovine can be used to study osteoporosis.
    • Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 2


    • The importance of peptides:
    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.



    Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 3

    Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 4 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 5 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 6 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 7



      Company Profile



    Xingtai xinkaiyue Technology Co., Ltd. was founded in 2019 has strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. We effectively promote joint ventures and cooperation with major enterprises and manufacturers, and serve the society and the majority of users with the idea of industrialized development. We always adhere to the market demand-oriented, and constantly synthesize new chemical products and pharmaceutical intermediates with high technical content, mainly exported to the United States, India, South Africa, Nigeria and many other countries and regions, with rich experience in export, to ensure the safety of transportation, and to be able to let every customer receive the goods safely as early as possible.

    Related certifications

      


    OPTIMIZED, AUTOMATED HIGH-YIELD PRODUCTION

    Shop Buy Weight Reduction Peptide Tirzetapide Tirze Injection Lyze-Dried Powder Vials 5mg 10mg 15mg CAS 2023788 19 2 Wholesale Price-Detailed Image 5 Shop Buy Weight Reduction Peptide Tirzetapide Tirze Injection Lyze-Dried Powder Vials 5mg 10mg 15mg CAS 2023788 19 2 Wholesale Price-Detailed Image 6 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 11


    ROBUST PROCESSES AND SUPPLY SECURITY

    Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 12

    Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 13




      Why choose us




    Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 14 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 15 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 16 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 17

    Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 18 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 19



    Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 20 Shop High quality latest batch of teriparatide CAS 12583-68-5 at favorable price-Detailed Image 21

    Basic Info
    Product Name:

    PARATHYROID HORMONE (1-34), BOVINE

    Other Name:

    ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE BOVINE;H-ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;BPTH 1-34;PTH (1-34) (BOVINE);TERIPARATIDE;PARATHYROID HORMONE (1-34), BOVINE

    CAS No.:

    12583-68-5

    Molecular Formula:

    C183H288N54O50S2

    Molecular Weight:

    4108.71

    EC Number:

    200-001-8

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Critical Temperature & Pressure:

    −20°C

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Peptides

    Location:

    Shop No. 47, Jixin Plaza, No. 26 Renmin Avenue, Renmin Street, Meilan District, Haikou City, Hainan Province

    Payment Terms:

    L/C,O/A,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2019

    Haikou Mingheng Technology Co., Ltd. is a modern and advanced enterprise specializing in the production and export of pharmaceutical intermediates, plant extracts, and other products. Products are widely used in health products, peptides and other fields. Our plant covers an area of 1000 m². The proposed workshop will be built according to GMP standards. We provide our customers with quality products and first-class service. Now, we can provide G-KG service to our customers.

    • High-Quality Peptides: Our company specializes in premium-grade peptides, ensuring the highest standards of purity and efficacy. Each product undergoes rigorous testing to guarantee superior quality and performance.

    • Cutting-Edge Technology: We leverage the latest advancements in peptide synthesis and production technology. Our state-of-the-art facilities and innovative processes enable us to deliver peptides with exceptional precision and consistency.

    • Custom Solutions: We offer tailored peptide solutions to meet the specific needs of our clients. Whether you require bespoke formulations or custom quantities, our experienced team is dedicated to providing personalized support and solutions.

    • Extensive Expertise: With years of experience in the peptide industry, our team of experts is well-versed in the complexities of peptide development and applications. We are committed to providing insightful guidance and technical support to help you achieve your goals.

    • Comprehensive Product Range: Our diverse portfolio of peptide products covers a wide range of applications, including research, pharmaceutical development, and cosmetic formulations. This allows us to cater to various industries and meet different customer needs.

      Company Profile

     




  • Inquiry History
    2 Inquiries
    Country Product Purchase Quantity Date Posted
    Canada

    Teriparatide

    5 MG Oct 28, 2025
    United States

    Parathyroid Hormone(1-34), bovine

    2 KG Oct 19, 2023
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.