Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37
Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 buy - large image1
Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 buy - image1
Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 buy - image2
Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 buy - image3
Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 buy - image4
Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 buy - image5
Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 buy - image6

Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37

TDS 3 Inquiries

Unit Price:

$70-90/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HK

Brand:

American peptide biotechnology LLC

Packaging:

10 vials/box

Price valid (until):

2027-06-30

Company Type:
Trader
Location:
United States
Payment Terms:
TT against copy of documents,100% TT in advance
Average Lead Time:
15 days
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    100% Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37

    Items Specifications


    Product Name


    Bodybuilding Peptide LL37


    Specifications


    10mg/vial 

    Package  10vials/box 


    American warehouse 


    yes 


    Shop USA Market American Safe Delivery Door To Door Bodybuilding Peptid Semaglutide-Detailed Image 1

    Shop USA Market American Safe Delivery Door To Door Bodybuilding Peptid Semaglutide-Detailed Image 2

    Shop USA Market American Safe Delivery Door To Door Bodybuilding Peptid Semaglutide-Detailed Image 3 Shop USA Market American Safe Delivery Door To Door Bodybuilding Peptid Semaglutide-Detailed Image 4

    Shop Customize Bodybuilding Supplement Powder Peptides Bodybuilding Tirzepatide 5mg 10mg 15mg 20mg 30mg-Detailed Image 1 Shop Customize Bodybuilding Supplement Powder Peptides Bodybuilding Tirzepatide 5mg 10mg 15mg 20mg 30mg-Detailed Image 2

    Product Packing:10mg/vial 10vials/box15mg/vial 10vials/box20mg/vial 10vials/box (Customized according to customer requirements)30mg/vial 10vials/box (Customized according to customer requirements)

    Shipping Condition:Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).Solubility: To be determinedShelf Life: >2 years if stored properlyDrug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Our Service:1.Cooperate with research institutions, we strictly control the process from raw material to finished product.2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.3.We can send the goods to your delivery address directly. It is relatively safe and fast.4.Quick and clear response to customers questions.5.We could make our price discount if you place a substantial order with us.

    Package and Shipment Service  1. By Express ------Suitable for under 50kg, Fast:3-7 days.High cost; Door to door service. Easy to pick up the goods.2. By Air  ------Suitable for more than 50 kg, Fast:3-7 days,High cost, airport to airport. professional broker needed.3. By sea------Suitable for more than 500kg. Slow: 5-45 days,Low cost. Port to Port, professional broker needed.


    FAQ

    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.


    Q2: Which payment is available for your company?

    Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.


    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery. For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Shop Customize Bodybuilding Supplement Powder Peptides Bodybuilding Tirzepatide 5mg 10mg 15mg 20mg 30mg-Detailed Image 3
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • Fast Delivery Bodybuilding Weight Loss Peptide Powder Great Quality Wholesale Price LL37 Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    1942 Broadway St. STE 314C Boulder CO 80302 US

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    15 days

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL 37

    1  Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product

More from this Seller

pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.