Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg
LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg buy - large image1
LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg buy - image1
LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg buy - image2
LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg buy - image3
LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg buy - image4
LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg buy - image5
LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg buy - image6

LL37 99% freeze dried powder cas154947-66-7 senwayer 5mg

Unit Price:

$96/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

ZQ

Packaging:

5mg*10vials

Price valid (until):

2027-07-24

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide

  • Product Description

  • Seller Information

  • Description


    Name:Lris

    email:lris@sjzenshi.com

    whatsapp:+85298496413


    Product Name:

    LL37


    Purity: ≥99%
    Colour White: Powder
    CAS NO. :  

    154947-66-7

    Molecular Formula: C187H291N45O59

    Custom content: 5mg  .

    Customized top color:Red Yellow Blue Black Purple White Green

    Storage: Store in cool and dry places, keep away from strong light.


    Packing:

    5mg*10vials 

    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 1

    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 2



    Function

    1.Treatment of depression and anxiety disorders: Retatrutide has been shown to have antidepressant and anxiolytic effects in preclinical studies, suggesting that it could be a promising treatment option for individuals with these conditions.

    2.Prevention of neurodegenerative diseases: Retatrutide has neuroprotective properties that may be useful in preventing or slowing the progression of neurodegenerative diseases such as Alzheimer's and Parkinson's.

    3.Enhancement of cognitive function: Retatrutide has been shown to improve learning and memory in animal studies, suggesting that it could have potential as a cognitive enhancer in humans.

    4.Treatment of chronic pain: Retatrutide has been shown to have analgesic effects in preclinical studies, suggesting that it could be a useful treatment option for individuals with chronic pain conditions.

    5.Promotion of wound healing:  Retatrutide  has been shown to accelerate wound healing in animal studies, suggesting that it could have potential as a therapeutic agent for promoting wound healing in humans.

    Application

    1.Retatrutide is often used in the pharmaceutical industry, weight losing, etc.

    2.Retatrutide is a kind of peptide product.

    3.Retatrutide acetate can inhibited GCGR, GIPR and GLP-1R.

    4.Retatrutide acetate is activated by glucagon receptors resulting in significant weight loss and increased energy expenditure.

    5.Retatrutide acetate can be used in studies of obesity.

      Benefits of the Application

    1. Retatrutide is often used in the pharmaceutical industry, weight losing, etc.
    2. Retatrutide is a kind of peptide product.
    3. Retatrutide acetate can inhibited GCGR, GIPR and GLP-1R.
    4. Retatrutide acetate is activated by glucagon receptors resulting in significant weight loss and increased energy expenditure.
    5. Retatrutide acetate can be used in studies of obesity.



    Key Specifications

    Items Specifications
    CAS Number

    154947-66-7

    Purity ≥98%(HPLC)
    Storage -20℃,potected from light and moisture
    Stability Stable for 2 years under recommended storage conditions




     

      Company Introduction  

    Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level.

    In addition, the factories have complete hardware facilities, including synthesis reactors with a full range of specifications from 20L to 500L, which can meet the production needs of different scales; purification and preparation liquid phase equipment are all available to ensure product purity and quality; a complete testing equipment matrix provides accurate data support for product quality control, which can fully meet customers' 100 kg product supply needs. Whether facing large-scale orders or complex customized requirements, we can cope with them with ease and provide customers with stable and reliable product supply.

    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 3

    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 4

    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 5

    Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.


    Product Usage  :

    Helps slow food leaving your stomach Helps the pancreas produce more insul when your blood sugar levels are high Can reduce hyperglycemia, especially after meals Has been shown to lower triglyceride levels and oxidative stress from high LDL Helps prevent your liver from making too much sugar Can help control blood glucose Can reduce fasting insul and fasting glucose Can decrease appetite and caloric intake, while inhibiting weight gain




    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 1  
    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 7

    FAQ:


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods?
    We could accept pay through paypal,bank transfer, X-Transfer and bitcoin.



    Packaging:
    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 8
    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 6
     

    Our Advantages:

    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 10

    Delivery Record:
    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 11 Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 12

    Customer Communication & Feedback:
    Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 13 Shop Cagrilintide Retatrutide tirzepatide semaglutide weight loss peptides in stock 10mg-Detailed Image 14

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide

    Location:

    hangzhou

    Payment Terms:

    TT against copy of documents,D/P,L/C,TT against B/L draft before shipment

    Average lead Time:

    2

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.