Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7
High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7 buy - large image1
High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7 buy - image1
High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7 buy - image2
High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7 buy - image3
High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7 buy - image4
High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7 buy - image5
High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7 buy - image6

High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7

TDS 1 Inquiries

Unit Price:

$77/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ShangHai

Brand:

RETA

Packaging:

5mg per vial; 10vials/box

Price valid (until):

2028-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides,Tirzepatide,Semaglutide,Retatrutide,MT2,Adipotide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Contact:

    Name: Tina
    Whatsapp:+86 15820903569

    Email:Tina@reta-peptide.com


      Product Detail  


      1. LL-37 is the only known human Cathelicidin is a big protein family where the members exhibit diverse functions. These peptides, essentially produced by macrophages and polymorphonuclear leukocytes (both types of white blood cells), have bactericidal action. They have been found to have shown other substantial effects as well. The entire group is often referred to as antimicrobial peptides (AMPs). LL-37 in particular has been found to play significant roles in autoimmune disease, cancer, and wound healing

    Shop High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7-Detailed Image 1

    Product Name LL37 CAS 597562-32-8 Cosmetic Raw Material Powder Janoshik 3rd Labtedting Injection Peptide with Best Price Hot Sale
    Product Name LL37
    CAS 597562-32-8
    MF C205H341N61O52
    EINECS NO 200-001-8
    Purity 99.8%
    Delivery 8-10Days
    Production Capacity 10 Tons/Month
    Payment method
    USDT,BTC,PAYPAL,ALIBABA,BANK TRANSFER,CREDIT CARD.ETC.
    Transport Package TNT, DHL, FedEx, UPS, EMS
    Shelf Life 2 Years


      Product Pictures  


    Shop High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7-Detailed Image 2 Shop High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7-Detailed Image 3 Shop High Quality LL37 Global Safe Delivery 99% Purity Customized Peptide CAS 154947-66-7-Detailed Image 4

    Shop Factory direct supply NAD high quality high purity low price CAS 53-84-9-Detailed Image 5  Shop Factory direct supply NAD high quality high purity low price CAS 53-84-9-Detailed Image 7 Shop Anti-Aging Raw Powder Epithalon High Purity Custom Peptide-Detailed Image 7


      Factory  


    Shop Anti-Aging Raw Powder Epithalon High Purity Custom Peptide-Detailed Image 8 Shop Hot Selling Cagrilintide High Purity Raw Material Powder Low Price High Quality-Detailed Image 9


      Delivery  


    Shop Factory direct supply NAD high quality high purity low price CAS 53-84-9-Detailed Image 10

    Note:

    1.High quality and competitive price.

    2.Promptly delivery by well-reputed shipping lines.

    3.Trial order is available for testing after samples.

    4.We will inform you all the information at every stage in advance.

    5.Packaging can gear to buyers’ special request.




    •  

        FAQ

       


      Q: Are you trading company or manufacturer?

      A: We are chemical manufacturerin China. Can provide the top quality and wholesale price.


      Q: Has the quality of your products passed the test of a third-party authoritative testing agency?

      A: Yes, all products are strictly tested by our quality control before shipment, and the quality assurance is confirmed and

      approved by third-party laboratories.  


      Q: How to confirm the Product Quality before placing orders?

      A: You can buy samples for some products,and there will be discount for sample, after testing our sample, if all is ok for you, when make bulk order, we can return the sample fee back to you, and you can also send us your requirement for some special item, we can found for you in our local market.


      Q: How to start orders or make payments?

      A: You can send your requirement here on line,or send your purchase order by email to us, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.


      Q: What's your MOQ?

      A: For this product, 2mg,5mg,10mg,15mg,20mg,30mg/vials, 1box is 10vials, minimum order is 1 boxes.


      Q: Is there a discount

      A: Different quantity has different discount, for larger quantity, we alway support with better price.


      Q: How to contact us?

      A: You can chat with us by Whatsapp & Skype & wechat Online. You can also choose your interested products and send inquiry to us. You can dial our telephone directly, you will get our reply.


      Q8: How about the delivery time?

      A8: The delivery time is about 7-15 days after confirming the payment. Delivery times vary from country to country. (excluding

      Chinese holidays)

    For payment: We can accept Bitcoin,Paypal, bank TT to company, bank TT to private account


      Our Advantages



    High quality --Coming from good materials and high technology.
    Lower price--Not cheapest but the lowest at the same quality.
    Good service--Satisfactory service before and after sale.

    1.We have multiple shipping ports, and have stock in the port warehouse, we can ship immediately.
    2. We have many years of export history, our products are very popular with many customers from all over the world.
    3.Our quality always best, supply free sample for customer test.
    4. We can supply best service, satisfy customer's all requirement.

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides,Tirzepatide,Semaglutide,Retatrutide,MT2,Adipotide

    Location:

    No. 17, Panchuan West Road, Panchuan Village, Tangxian Town, Yongkang City, Jinhua City, Zhejiang Province, 4th Floor

    Payment Terms:

    100% TT in advance

    Average lead Time:

    10

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

    Reta-peptide is a manufacturer of ( PEPTIDES ) with well-equipped testing facilities and strong technical force.

    With a wide range, good quality, reasonable prices and stylish designs, our products are extensively used in  Cosmetic  and other industries.

    Our products are widely recognized and trusted by users and can meet continuously changing economic and social needs.

    We welcome new and old customers from all walks of life to contact us for future business relationships and mutual success! 

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.