Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Glucagon for Sale > High Quality Manufacturer Supply Glucagon Hydrochloride CAS:16941-32-5
High Quality Manufacturer Supply Glucagon Hydrochloride   CAS:16941-32-5 buy - large image1
High Quality Manufacturer Supply Glucagon Hydrochloride   CAS:16941-32-5 buy - image1
High Quality Manufacturer Supply Glucagon Hydrochloride   CAS:16941-32-5 buy - image2
High Quality Manufacturer Supply Glucagon Hydrochloride   CAS:16941-32-5 buy - image3
High Quality Manufacturer Supply Glucagon Hydrochloride   CAS:16941-32-5 buy - image4
High Quality Manufacturer Supply Glucagon Hydrochloride   CAS:16941-32-5 buy - image5

High Quality Manufacturer Supply Glucagon Hydrochloride CAS:16941-32-5

4 Inquiries

Unit Price: Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Packaging:

1kg/bag;25kg/Cardboard Drum

Price valid (until):

2025-01-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Estradiol,Progesterone,GS441524,4-Butylresorcinol,DeoxyArbutin,Coenzyme Q10

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Superiority

    We are the manufacturers and suppliers of API in China, and warehouse in Germany and USA of California, which can quickly and safely deliver to your address

    1.High quality and competitive price.
    2.Free sample for your evaluation.
    3.Promptly delivery by well-reputed shipping lines.
    4.Trial order is available for testing after samples.
    5.We will inform you all the information at every stage in advance.
    6.Packaging can gear to buyers' special request. 

    Our service

    1. Reply your inquiry in 24 working hours.
    2. Customized design is available. OEM are welcomed.
    3. Exclusive and unique solution can be provided to our customer by our well-trained and professional engineers and
    staff.
    4. Professional factory: We are manufacturer, specializing in producing all kinds of herb extract for more than 10 years, competitive with good quantity.
    5. As an honest seller, we always use superior raw material, advanced machines, skilled technicians to ensure our products to be finished in high quality and stable feature.




    Shop High Quality Manufacturer Supply Glucagon Hydrochloride   CAS:16941-32-5-Detailed Image 1 Shop High Quality Manufacturer Supply Glucagon Hydrochloride   CAS:16941-32-5-Detailed Image 2









    FAQ


    1.: Are you a factory or trading company
    We are the integration of factory and trade.


    2.: How is the quality I want to test.
    Before production and extraction, we will test all raw materials.Quality is our top priority.All products are strictly tested and confirmed by our QC and QA, approved by Third Party Lab in China.So you will be assured with Good Quality if you choose us. We welcome you test the product and hope to get your feedback.


    3.: Can I get a Free sample
    Yes,We can provide free samples.For most products we can provide you a free sample, You only need to pay for Shipping. Plesae be free to consult our salesman.
    For a larger quantity, we always support you with better price, and we will have some discount in some especial days.


    4. : What's your main payment method
    T/T (Bank transfer), Wechat,Alipay,Credit card payment.


    5. : Have you received my payment How long will it take
    Generally, we can receive your payment the next day, and we will inform you as soon as we receive your payment.
    After confirmation payment, we will send out package


    6.:When will you sent out the goods after successful payment
    Normally the order will be delivery within 1-3 days after the order confirmed, except the customized products.


    7.:What modes of transportation do you have to choose
    We cooperate with HKEMS, DHL, TNT, UPS, FEDEX, EMS, China Air Post ,sea transportation etc.
    And with the SAFE SHIPPING in each country, you can receive the goods smoothly.It is fast and safe method.


    8.:How long does it take to the goods arrived
    It is Depending on your location:
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, HKEMS,Netherlands post.
    For large order, please allow 5-8 days by Air, 20-35 days by Sea
    At the same time, we have warehouses in Germany and California, and some orders can be sent directly from Germany or California.


    9.:How is the goods packed
    We usually send goods with disguise package outside and a double-layer sterile transparent bag inside.We have tried thousand of package methods, it looks serious and discreet.


    10.: How can I get a discount
    Our products have already given you a discount, and the price is favorable. Orders above $1,000 can enjoy 95% discount, transportation discount or additional sample products. Therefore, for larger quantities, we always support better prices.


    11.: How to proceed order
    Please Let me konw the product you are looking for,quantity and the destination country wihch help me to give you a right price;
    After you confirm all details of order, pay money in advance and give us Shipping address.We arrange the shipment at first time after receive payment and offer after-sales service after you receive parcel.


    12.:When will I receive the shipping number Where I can check status of my order
    After the goods are sent out, our staff will send you the shipping number via email, online or WhatsApp ASAP.You can also check the status online on 17track.


    13.:Is a signature required for the shipping?
    Our shipping method requires no signature from your side upon delivery.

    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Estradiol,Progesterone,GS441524,4-Butylresorcinol,DeoxyArbutin,Coenzyme Q10

    Location:

    XINYUAN DADUHUI PHASE 1, NO.258 TAOYUAN NORTH ROAD, LIANHU DISTRICT, XI 'AN , SHAANXI CHINA

    Payment Terms:

    TT against copy of documents,100% TT in advance

    Average lead Time:

    30

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    11-50

    Year of Establishment:

    2023




      Company Profile  


  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.