Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose buy - large image1
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose buy - image1
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose buy - image2
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose buy - image3
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose buy - image4
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose buy - image5
Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose buy - image6

Factory Wholesale Price Hot sale LL-37 99% white powder LL-37 peptide Weight Lose

3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

DL

Packaging:

10mg/vial,10vials/box

Price valid (until):

2025-04-05

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Sales manager:Smile

    whatsapp:+8617832002339  

    Email:smile@duole-tech.com

    Items Specifications
    Product Name Tirzepatide
    CAS No. 2023788-19-2
    Molecular Formula C225H348N48O68
    Appearance White Powder
    Packaging 10mg/vial, 10vials/box
    MOQ 10vials

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 1

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 2

    Tirzepatide has been shown to help lose weight in overweight patients. Phase 3 clinical trials are currently underway for weight loss in adults who are overweight, obese, or have weight-related health issues. Tirzepatide has received FDA Fast Track designation to speed up its FDA application for treating adults with obesity, or who are overweight with weight-related health conditions.
    In the SURMOUNT-1 clinical trial, the average weight loss with tirzepatide after 72 weeks was 15% for the 5mg dose, 19.5% for the 10mg dose, and 20.9% for the 15mg dose.

    tirzepatide is a once-weekly glucose-dependent-stimulating polypeptide (GIP, aka: gastric inhibitory polypeptide) receptor and glucagon-like peptide-1 (GLP-1) receptor dual agonist developed by scientists. ChemicalbookGIP and GLP-1 are both hormones secreted by the gut that promote secretion. tirzepatide combines the effects of two -promoting drugs into a single molecule and represents a new class of drugs for the treatment of type 2 diabetes.

    How much weight can you lose in a week with tirzepatide?
    Clinical trials have shown that study participants taking a weekly dose of semaglutide had an average reduction in body weight of 5-10 percent.

    Description:

    Tirzepatide (LY3298176) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes. Tirzepatide (LY3298176) shows significantly better efficacy with regard to glucose control and weight loss than do Dulaglutide.

    Tirzepatide, also known as LY 3298176, is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist. Tirzepatide has a greater affinity to GIP receptors than to GLP-1 receptors, and this dual agonist behavior has been shown to produce greater reductions of hyperglycemia compared to a selective GLP-1 receptor agonist. Signaling studies reported that tirzepatide mimics the actions of natural GIP at the GIP receptor. Tirzepatide was approved for improving blood sugar control in adults with type 2 diabetes, as an addition to diet and exercise.


    Product picture:

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 3

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 4


    Before and after weight loss:

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 5

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 6

    Product Name Tirzepatide
    Purity ≥99%
    Colour White Powder
    CAS NO. 2023788-19-2
    Molecular Formula C225H348N48O68
    Molecular Weight 4813.527g/mol
    Storage Store in cool and dry places, keep away from strong light.


    Packing:

    10mg/vial 10vials/box

    15mg/vial 10vials/box

    20mg/vial 10vials/box

    30mg/vial 10vials/box


    Real customer case:

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 7

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 8

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 9


    Tracking number:

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 10


    Advantage&Packing:

    Shop Peptide Semaglutide 10mg US warehouse low price high quality fast delivery-Detailed Image 8

    Shipping:

    Shop Peptide Semaglutide 10mg US warehouse low price high quality fast delivery-Detailed Image 9


    Company Profile:

       

    Changsha Duole Technology Co., LTD was established in 2023 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products and medical intermediates.

    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.

    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance issues.

    We look forward to your letter, welcome new and old customers to contact us, common development!

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 13


    Production equipment:

    Shop High Quality and Low Price Obesity Tirzepatide Peptides for Weight Loss-Detailed Image 14



    1.COA/MSDS/ROS/MOA Available.
    2.Any inquiries will be replied within 12 hours.
    3. Dedication to quality, supply & service.
    4.Strictly on selecting raw materials.
    5.Reasonable & competitive price, fast lead time.
    6.Faster delivery:Sample order in stock and one week for bulk production.
    7.We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.
    8.Timely after-service resolves your worry for internation trade.

    

    FAQ:


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods?
    We could accept pay through paypal,bank transfer, X-Transfer and bitcoin.

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

    Research
    Class:

    Dual agonist — GIPR, GLP-1R

    Status:

    FDA-approved (Mounjaro / Zepbound)

    Mechanism:

    Dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist. A 39-amino-acid modified peptide with a C20 fatty diacid moiety that enables albumin binding for extended half-life (~5 days). Selectively activates both GIPR and GLP-1R signaling pathways.

    EC50 (Human GLP1R):

    0.934 nM

    EC50 (Human GIPR):

    0.0224 nM

    Source:

    Frias JP, et al. N Engl J Med. 2021;385(6):503-515.DOI

    FDA:

    Mounjaro, Zepbound (approved 2022-05-13)

    References
    ChEMBL:

    CHEMBL4297839

    DrugBank:

    DB15171

    KEGG DRUG:

    D11360

    PubChem:

    PubChem

    Disclaimer:

    Tirzepatide is approved as a prescription medicine (Mounjaro, Zepbound) in certain jurisdictions. This listing is for industrial and laboratory research use only. Research-chemical listings on B2B marketplaces are not interchangeable with approved medicines. Confirm CAS, specification, and regulatory pathway with the seller. It is not medical advice, a clinical recommendation, or an approved therapy description.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide

    Location:

    Room 1811-A096, Jingu Building, No.319 Jinxing Middle Road, Xihu Street, Yuelu District, Changsha City, Hunan Province

    Payment Terms:

    TT against copy of documents

    Average lead Time:

    2

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

    Duole Technology Co., LTD was established in 2020 with strong research and development capabilities and superb synthesis technology, as well as advanced quality control measures. Effectively promote the joint venture and cooperation with the major enterprises, manufacturers, with the idea of industrial development to serve the society and the majority of users. We always adhere to the market demand as the orientation, constantly synthesizing new high-tech chemical products and medical intermediates.

    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.

    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance issues.

    We look forward to your letter, welcome new and old customers to contact us, common development!

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.