Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity buy - large image1
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity buy - image1
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity buy - image2
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity buy - image3
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity buy - image4
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity buy - image5
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity buy - image6

Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity

TDS 1 Inquiries

Unit Price:

$65-80/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ANY

Brand:

TNJONE

Packaging:

10vials/box: 5mg-30mg Bag: 0.1g, 1g, 10g, 100g, 1kg, 5kg,10kg

Price valid (until):

2026-12-29

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,API,Vitamins,Food Additive

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity


    Contact Information:
    Whatsapp :+86-18092446649
    Email :sarah@tnjone.com


    Description:

      • LL 37 is a peptide that features 37 amino acids derived from the C-terminal of a larger protein in your body known as cathelicidin. Cathelicidin (hCAP18) exists as the only naturally-produced human cathelicidin in existence. The compound is found in multiple parts of the body and produces an amino acid sequence that begins with 2 leucines (hence the double L).LL 37 peptide is tasked with eliminating foreign micro-organisms through membrane disruption. Nevertheless, the peptide is not simply a bacteria-fighting peptide. Rather, the peptide is capable of treating allergic rhinitis in children as well as bronchiolitis. The peptide was created in the mid-1990s to examine Antimicrobial Resistance (AMR).

        As a result, its primary function is to treat microbial infections, especially infections caused by antibiotic-resistant pathogens.LL 37 peptide features several advantages over conventional antibiotics including lower levels of resistance and rapid killing of dangerous bacteria.In the end, the peptide is one of the best candidates to overcome antibiotic resistance.

    •  

      Items Specifications
      Products Name: LL 37
      CAS No.: 597562-32-8
      Appearance: White powder


    Appearance: Powder

    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    HS Tariff Code: 2934.99.9001

    Application: FOR WEIGHT LOSS


    Shop Tirzepatide 5mg 10mg 15mg 30mg Over Filled GLP1 customize Lyophilized powder-Detailed Image 1

    Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 2

    Other hot selling products:


    Semaglutide is a new generation GLP-1 (glucagon-like peptide-1) analogues. Semaglutide is a long-acting dosage form based on the basic structure of liraglutide, which is more effective in the treatment of type 2 diabetes mellitus. Compared with lilarlutide, somalutide has a longer aliphobic chain and an increased hydrophobicity, but somalutide is modified with a short chain of PEG, and its hydrophilicity is greatly enhanced.PEG modification can not only tightly bind to albumin, cover up the DPP-4 enzymatic hydrolysis site, but also reduce renal excretion, prolong the biological half-life, and achieve the effect of long circulation.

    Molecular Weight: 4813.45

    Appearance: White Powder

    Purity (HPLC): ≥99.0%

    Single Impurity (HPLC): ≤1.0%

    Moisture Content (Karl Fischer): ≤10.0%

    Peptide Content: ≥80.0%

    Storage: Store at -20℃ degrees Celsius in a dry and cool place.

    Storage Condition: Store at -20°C Solubility in DMSO: 3mg/mL (0.73 mM)


    SEMAGLUTIDE & TIRZEPATIDE


    GLP-1 agonists were approved by the FDA for weight loss in late 2014. It's a newer class of drugs better known for its ability to improve blood sugar control. These medications were actually designed to treat type II diabetes, but some have also been FDA approved to treat weight loss. The GLP-1 agonists we work with are called Semaglutide & Tirzepatide. 
    Tirzepatide is dosed at 5-15mg per week

    Semaglutide is dosed at 0.5-2.4mg per week

    Product Function:

    • Helps slow food leaving your stomach
    • Helps prevent your liver from making too much sugar
    • Helps the pancreas produce more insul when your blood sugar levels are high
    • Can help control blood glucose
    • Can reduce hyperglycemia, especially after meals
    • Can reduce fasting insul and fasting glucose
    • Can reduce hemoglobin A1c
    • Can decrease appetite and caloric intake, while inhibiting weight gain
    • Has been shown to lower triglyceride levels and oxidative stress from high LDL
    • Has been shown to help induce weight loss in obese patients with higher dosing
    • Helps decrease leptin and increase leptin sensitivity
    • Can increase the conversion of white fat to brown fat
    • Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 3 Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 4 Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 5

    Company Information 
    Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 6 Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 7






    Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 8 Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 9

    Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 10
    Shop Best Quality Liraglutide Slimming Weight Lose Liraglutide 5mg 10mg Custom Peptide-Detailed Image 11

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Semaglutide,Tirzepatide,API,Vitamins,Food Additive

    Location:

    No. 4C-11-A392, Financial Port, Northwest corner of Fengjing Avenue and Fengxin Road, Fengdong New City, Xi 'an, Shaanxi Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2019

    Shaanxi TNJONE Pharmaceutical Technology Co., LTD., located in the beautiful ancient capital Xi 'an, is committed to the peptide industry, pharmaceutical raw materials, food and feed additives, veterinary drugs and other fields, the enterprise adhering to provide customers with quality service, supply high-quality products, "world peace and health" as its responsibility, the company adhering to the "meet all customer requirements for products" as the service concept, Guarantee "provide qualified products" as the service principle, so that you get "God-like" noble shopping enjoyment. Our company has more than 1000 kinds of polypeptides, raw materials inventory, at any time to meet the various needs of customers for products. Is your best partner.
  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.