Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity buy - large image1
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity buy - image1
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity buy - image2
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity buy - image3
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity buy - image4
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity buy - image5
wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity buy - image6

wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity

3 Inquiries

Unit Price:

$100-130/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HK

Brand:

Shanxi Hongruichang International Trade LLC

Packaging:

10 vials per box

Price valid (until):

2027-01-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Cosmetic raw material,API,Fertilizer,Semaglutide,Tirzepatide,Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


       Product Detail  



    wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity

    Shop Highly effective weight loss slimming Semaglutide peptide powder 20mg-Detailed Image 1


    Items Specifications
    Product Name LL37
    Purity 99%
    Specification 10 vials per box
    Appearance White Powder


    Shop Highly effective weight loss slimming Semaglutide peptide powder 20mg-Detailed Image 2 Shop Highly effective weight loss slimming Semaglutide peptide powder 20mg-Detailed Image 3

    Shop Top grade factory price Trizepatide, semaglutide and retraglutide in stock-Detailed Image 4

    Shop Highly effective weight loss slimming Semaglutide peptide powder 20mg-Detailed Image 5

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 6


       About US


    We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. Provide samples before regular order. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.

    Our goal is to survive by quality and develop by reputation. We adhere to rigorous quality control standards, ensuring high purity and accurate peptide sequences. 

    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work. Meet the new and old customers to buy.

    Our Service:

    1.Cooperate with research institutions, we strictly control the process from raw material to finished product.

    2.The customer comes first, we provide reasonable price, high quality product and prompt shipment.

    3.We can send the goods to your delivery address directly. It is relatively safe and fast.

    4.Quick and clear response to customers questions.

    5.We could make our price discount if you place a substantial order with us.

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 7

    Shop Top grade factory price Trizepatide, semaglutide and retraglutide in stock-Detailed Image 8

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 8 Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 9


       Package & Delivery


    Product Packing:10mg/vial 10vials/box15mg/vial 10vials/box20mg/vial 10vials/box (Customized according to customer requirements)30mg/vial 10vials/box (Customized according to customer requirements)

    Shipping Condition:Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place

    • Avoid repeated freezing and thawing of peptide

    • Avoid overexposure to the air • Avoid light exposure

    • Avoid storing peptides in solution long term

    

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 10

    Shop Tirzepatide CAS 2023788-19-2 15mg Vial Minimum order quantity In stock High purity Low price-Detailed Image 11


       FAQ 


    Q1: Have your Product Quality been Approved by Third Party Lab?

    A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us.

    Q2: How to cooperate with us?

    You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email. 

    Q3: Is there any discount?

    A: Yes, for larger quantity, we always support with better price. 

    Q4: Do you accept VISA business credit card?

    A: Sorry we don't accept VISA credit card,
    We'd like to accept bitcoin, USDT, bank transfer, paypal etc.

    Q5: How long does it take to the goods arrived?

    A:It is Depending on your location.
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS.
    For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

    Q6: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q7: Do you have any reshipment policy ?

    We have good after-sale service and re-shipment policy if the parcel  lose.
    Our long association with  our clients has brought great benefits.
    We always take the upmost care in the packaging of our products .
    Our clients will confirm this as even they struggle to find them without help at times.
    But in spite of our best efforts it is still possible  will seize a small number of packages.
    In this circumstance we promise reship free  to establish  long term relationship.


    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    wholesales peptides Cas 154947-66-7 LL37 5mg with high quatity is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Cosmetic raw material,API,Fertilizer,Semaglutide,Tirzepatide,Retatrutide

    Location:

    taiyuan

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Year of Establishment:

    2015

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.