Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide
High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide buy - large image1
High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide buy - image1
High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide buy - image2
High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide buy - image3
High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide buy - image4
High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide buy - image5
High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide buy - image6

High purity 99% Purity Chemical Weight Slimming Peptides Fat Lose Peptides Ll37 Ss31 Motsc Cagrilintide for Anti-Obesity Peptide

COA TDS

Unit Price:

$10/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmacy Grade Cosmetics Grade Chemical Grade

Content:

99.9%

Port:

shanghai

Brand:

sy

Packaging:

10vials/box

Price valid (until):

2028-07-07

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Peptides,steriods oil,pharmaceutical intermediates,chemical,raw powder,Retatrutide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Note: Due to policy changes, some products have not been disclosed on here. However, you can still ask us for quotations via email, phone, WhatsApp and WeChat.

    If you couldn't find the product you want in our store, maybe we haven't uploaded the complete product, please feel free to contact us through various ways; if you want to customize and process the product you want, please feel free to contact us for more details too. 

    Shop High purity Bac Water Bacteriostatic Water 10ml 30ml Combined with Peptide tirzepatide cas 7732-18-5-Detailed Image 1

    Shop High purity Bac Water Bacteriostatic Water 10ml 30ml Combined with Peptide tirzepatide cas 7732-18-5-Detailed Image 2 Shop High quality Bac Water Bacteriostatic Water 10ml 30ml Combined with Peptide tirzepatide cas 7732-18-5-Detailed Image 1 Shop High quality Bac Water Bacteriostatic Water 10ml 30ml Combined with Peptide tirzepatide cas 7732-18-5-Detailed Image 2

    Shop Factory price top quality CAS 2023788-19-2 Tirzepatide Peptide Weight Loss GLP-1-Detailed Image 1

    Shop Pharmaceutical Product Peptides Cagrilintide Retatrutide Slimming Injection Weight Lose peptide-Detailed Image 4 Shop High quality Bac Water Bacteriostatic Water 10ml 30ml Combined with Peptide tirzepatide cas 7732-18-5-Detailed Image 5

    Items Specifications
    Name bac water
    Purity >99%
    Appearance White
    storage store in cool and dry place
    Origin China

    Shop Factory price top quality CAS 2023788-19-2 Tirzepatide Peptide Weight Loss GLP-1-Detailed Image 8

    1. Product function
    2. 1.Treatment of depression and anxiety disorders:  Retatrutide  has been shown to have antidepressant and anxiolytic effects in preclinical studies, suggesting that it could be a promising treatment option for individuals with these conditions.
    3. 2.Prevention of neurodegenerative diseases:  Retatrutide  has neuroprotective properties that may be useful in preventing or slowing the progression of neurodegenerative diseases such as Alzheimer's and Parkinson's.
    4. 3.Enhancement of cognitive function:  Retatrutide  has been shown to improve learning and memory in animal studies, suggesting that it could have potential as a cognitive enhancer in humans.
    5. 4.Treatment of chronic pain: Retatrutide has been shown to have analgesic effects in preclinical studies, suggesting that it could be a useful treatment option for individuals with chronic pain conditions.
    6. 5.Promotion of wound healing:  Retatrutide  has been shown to accelerate wound healing in animal studies, suggesting that it could have potential as a therapeutic agent for promoting wound healing in humans.
    Our customers are all over the world, mainly selling in the United States, Canada, Australia, the United. Kingdom, the Ne  therlands, Germany, France and other EU countries, Southeast Asia, South America, and Oceania. We also have many customers.
     Our business is based on honesty and mutual trust. Sincerely look forward to establishing long-term mutually beneficial business relationships with customers around the world.

    FAQ

    

    Q1. How do you ensure product quality?

    1. We implement a rigorous quality management system, ensuring every batch undergoes comprehensive testing to meet our stringent standards before entering our warehouse.

    2. Our quality assurance team conducts thorough rechecks to validate product quality prior to dispatch.

    3. For absolute certainty, we can dispatch samples to esteemed third-party testing agencies for detailed analysis and verification reports

    . Q2. How can we place an order?

    1. Start by conveying your specific requirements to us.

    2. We will present you with optimal product choices and competitive quotations tailored to your needs.

    3. To confirm product integrity, we provide a comprehensive Certificate of Analysis (COA) and pertinent test spectra or samples.

    4. Upon agreement on quality and pricing, a Proforma Invoice (PI) will be promptly issued.

    5. Proceed by confirming your order, completing the payment, and forwarding the payment slip to us.6. We will meticulously reconfirm all details before shipping and efficiently coordinate the logistics for shipment.

    Q3. Can I have a sample order?

    Yes, welcome to place an sample order to check quality or marke

    Q4. What is your lead time for a new order?

    For stocked items, anticipate a swift delivery within 3-5 business days following payment receipt. For customized orders, we invite a detailed discussion to ensure precision.

    Q5. Do you offer custom services?

    Certainly, we offer bespoke customization services encompassing product specifications, packaging, and exclusive production options to cater to your distinctive needs.


    

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Peptides,steriods oil,pharmaceutical intermediates,chemical,raw powder,Retatrutide

    Location:

    15b3-1, Building 3, China Plastic City International Business Center, No. 285 Shunda West Road, Yangming Street, Ningbo, Zhejiang, China

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.