Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Fat Medicines > LL-37 for Sale > Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides
Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides buy - large image1
Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides buy - image1
Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides buy - image2
Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides buy - image3
Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides buy - image4
Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides buy - image5
Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides buy - image6

Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides

TDS 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ningbo

Brand:

SYSH

Packaging:

10 Vail/box

Price valid (until):

2025-12-31

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Peptides,steriods oil,pharmaceutical intermediates,chemical,raw powder,Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    We provide different types of peptides with high quality and competitive prices.

    Our customers who purchased peptides are very satisfied and shared positive feedback.

    Reliable buyers from around the world are welcome to contact us for more details about our peptides.


    Fast Delivery: Reliable and efficient shipping, ensuring your products arrive on time.

    Top Quality: Upholding excellent standards for unparalleled product performance.

    Quality Service: Providing dedicated support to create an outstanding customer experience.

    Secure Shipping: Guaranteeing safe and dependable product delivery.

    Competitive Prices: Delivering great value while maintaining premium quality.


    Are you from these countries?
    United States, Canada, Spain, Portugal, Australia, Brazil, France, Netherlands, United Kingdom, Bulgaria, Norway, and more.

    Good News! We guarantee smooth customs clearance in key destinations, including Germany and Finland, with no issues at all. Your packages will be securely delivered within 5-15 days.



     Why Choose Us



    Fast Delivery: We ship your order quickly using DHL, FedEx, and other options. Most orders arrive in 5-15 days.

    Customs Clearance: No customs problems! We make sure your order is delivered smoothly.

    Easy Payment: Pay with Bitcoin or bank transfer.

    Good Quality: Our products are great, and we support small test orders.




    Items Specifications
    Package 5mg, 10mg, 15mg, 20mg or 30mg per vial, 10 vials/kit
    Delivery time 1-2 days
    Appearance

    Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 1 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 2 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 3 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 4 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 5 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 6


      Product Packaging


    Packaging: Available in 5mg, 10mg, 15mg, 20mg or 30mg per vial, 10 vials/kit , or custom packaging upon request.

    Storage: Store in a cool, dry place away from light and moisture to maintain its stability.


    Payment Methods: Bank Transfer, Bitcoin

    Delivery Options: Express Shipping (EMS, DHL, TNT, FedEx, UPS) or Bulk Transport by Sea/Air

    Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 7 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 8 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 9 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 10 Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 11




    Company Profile   


    Our company is established in 2010, which is a fast growing intermediate company located in Yuyao, Zhejiang Province. After ten years of development, Ningbo Shuyou has become a diversified company, not only involved in Pharmaceutical Intermediates, but also in the field of agricultural products. Also Have factory for plastic&rubbler granule, So far, Ningbo Shuyou has operations in 35 countries, and most of its big customers are from Europe and the United States. The quality of Ningbo Shuyou products is always the best among Chinese suppliers, with some products of 99.9+ purity. This is an important reason for customers to choose.

    Shop Snap-8 Peptide Powder CAS 1253115-75-1 RAW POWDER free samples-Detailed Image 12


     FAQ 


    Q1: Can I get some samples?

    A: Yes, samples are available. However, customers are responsible for the shipping cost.


    Q2: How can I make a payment?

    A: We accept various payment methods, including T/T, BTC and other options.


    Q3: What is your MOQ (Minimum Order Quantity)?

    A: Our standard MOQ is 1 kilogram. However, smaller quantities, such as 100 grams, can be arranged with an applicable sample charge.


    Q4: What is the shipping time?

    A: Orders are typically shipped within 3-7 days, with tracking numbers provided. Delivery times vary depending on the destination. Please contact us for detailed information.

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Fast delivery free samples Semax Lyophilized Powder/Raw Powder Peptides is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Fat Medicines

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Peptides,steriods oil,pharmaceutical intermediates,chemical,raw powder,Retatrutide

    Location:

    15b3-1, Building 3, China Plastic City International Business Center, No. 285 Shunda West Road, Yangming Street, Ningbo, Zhejiang, China

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.