Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding
LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding buy - large image1
LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding buy - image1
LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding buy - image2
LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding buy - image3
LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding buy - image4
LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding buy - image5
LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding buy - image6

LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding

3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

Qingdao

Brand:

Shangdong Enci Chmical

Packaging:

5mg*10vials

Price valid (until):

2025-11-24

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU,MOTS-C,TB500

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Whatsapp:+852 51365637

    Email: lidiawang821@gmail.com

    WeChat: +852 51365637




    Shandong Enci Chemcial Co., Ltd was established in 2023. Although we are a very young company, our leaders have been working in the chemical industry for 20 years. We believe that our company can bring you perfect customer experience.

    We can provide you with chemical raw materials, chemical products, pharmaceutical intermediates, veterinary intermediates, dye intermediates, pigments, cosmetic raw materials and chemical reagents, can meet your various needs. Since the establishment of the company, adhere to the "quality first, customer first, integrity-based" business policy, always strive to meet the potential needs of customers. The trend of economic globalization is unstoppable. Our company is willing to cooperate sincerely with enterprises around the world to achieve a win-win situation.
    We have been focusing on multiple areas of research and development, manufacturing, sales and service. Our sales and marketing office is located in Hebei Province, China, close to tianjin port, Qingdao port and other ports, providing great convenience for the integrated sales and purchasing of all our factories.
    With consistent chemical quality, technology and service, quality products and services, and customers in all aspects to grow together. We believe that our full range of products will give you the impression of the best expectations and innovations made in China.
    If you are interested in our company and our products, please feel free to visit our website or contact us directly for more information. We look forward to establishing long-term stable and win-win business relationship with you.
    You can contact us if you have any requirements, we accept customized services.
    Shandong Enci Chemcial Co., Ltd is willing to grow with friends all over the world!

    Whatsapp:+85251365637

    Items Specifications
    CAS NO 154947-66-7
    Shape White powder
    Molecular formula C101H152N28O22S2


      FAQ 



    Q1. How do you ensure product quality?
    A1. We have a strict quality management system in place. All batches must pass tests and meet our standards before being released into the warehouse.

    Q2: Why should you buy from us instead of other suppliers?

    A2: Because we are a factory, we can provide lower prices and guaranteed quality. We have extensive experience in domestic and foreign trade and provide services in an honest, timely and efficient manner.

    Q3: How to place an order for each product?

    A3: Please send us an inquiry and let us know your requirements; we will send you a complete quotation including freight, confirm the order and send payment/deposit, we will arrange production or delivery of the goods after receiving the bank receipt.

    Q4: Do you have stock?
    A4: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 1 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 2 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 3 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 4 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 5 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 6 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 7 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 8 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 9 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 10 Shop HGH191AA Good effect High quality, high purity, low price-Detailed Image 11

    This product of our company works very well. First of all, it has a lower price. Secondly, we have higher purity and better service attitude. The effect of this product is very good. If you want to know more, please contact me: Whatsapp: +85251365637

    It appears as a white, freeze-dried powder with no noticeable odor. Its basic structure consists of a series of amino acids. The compound is water-soluble.Our company can provide various types of high-quality peptide products.We have fast and safe delivery, the purity of our peptide products is >99%, and we have perfect after-sales service

    Our products are synonymous with high quality, each embodying our exquisite craftsmanship and premium materials.

    Our products offer exceptional performance and superior quality, reaching industry-leading standards in both design and performance.

    Our products are not only innovative and unique, but also feature comprehensive functionality, satisfying consumers' demands for quality and functionality, making their lives more convenient and comfortable.

    Our products have consistently earned unanimous praise from consumers worldwide for their superior quality, reliable performance, and exquisite design.

    Our products demonstrate exceptional stability and reliability, withstanding years of market experience and earning them a trusted brand.

    WhatsApp: +852 51365637

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 High quality, high purity, low price, peptide products weight loss, bodybuilding is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU,MOTS-C,TB500

    Location:

    zibo

    Payment Terms:

    TT against copy of documents,D/A,O/A,100% TT in advance

    Total Employees:

    5-10

    Year of Establishment:

    2025

    CoAs a peptide manufacturer, our products include Retatrutide, Tirzepatide, semaglutide, etc. Our products are of good quality and high purity. Welcome to consult and place an order.
  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.