Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Factory direct LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured
Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured buy - large image1
Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured buy - image1
Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured buy - image2
Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured buy - image3
Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured buy - image4
Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured buy - image5
Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured buy - image6

Factory direct LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured

3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou

Brand:

SH

Packaging:

5 mg/vial

Price valid (until):

2026-08-19

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Sales manager:Lynn
    whatsapp:+852 94453140
    Email:Sales04@adsh.top





    Company Introduction
    Shanxi An Da Si Hai Technology Co., Ltd. is a professional manufacturer of various peptide products and chemical raw materials.
    We have a dedicated R&D team and a reliable, efficient logistics team to ensure you receive high-quality products safely and promptly. Our customers come from countries including the United States, Europe,
    Europe, Japan, South Korea, and India. Most of our main products are in stock and ready for immediate shipment. Please let us know the specific quantity you need, and we will offer you the most competitive price. Feel free to contact us for more information.

    We offer various types of peptides,are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.about the peptides,we can provide the good quality,the good price.Customers who have ordered our products(peptides)have had very good feedback.
    World wide relaible buyers can contact us about the peptides.

    1. Superior Product Quality

    Product quality is the foundation of our business. Peptides are synthesized using solid-phase peptide synthesis (SPPS), then purified through HPLC and confirmed by mass spectrometry (MS).

    Each batch includes a Certificate of Analysis (COA) with key data:
    • Purity (HPLC)
    • Molecular weight (MS)
    • Water content
    • Residual solvents
    • Microbial limit (if applicable)

    For clients with higher regulatory demands, we also provide third-party testing reports, endotoxin (LAL) data, and stability studies upon request.

    2. Customization & R&D Support

    We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

    Our services include:
    • Custom peptide synthesis (mg to kg scale)
    • Peptide modifications and labeling
    • Small molecule synthesis
    • Project-based research and scale-up

    We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.

    3. Wide Product Portfolio

    We supply a comprehensive and expanding product range:
    • Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.
    • Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.
    • Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

    New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal demand.

    Shop Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured-Detailed Image 1

    L L-37
    Bioactive
    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.

    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    Shop Factory direct  LL37 154947-66-7 Top quality Quality Guarantee After Sales Assured-Detailed Image 2

    Application:

    1. LL37 has been used as an antimicrobial agent to improve wound healing.

    2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

    3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

    4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

    5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

    6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

    Shop Hot sale Top quality selank Professional-Grade Customizable Options Quality Guarantee After Sales Assured 129954-34-3-Detailed Image 5

    Shop Hot sale Top quality selank Professional-Grade Customizable Options Quality Guarantee After Sales Assured 129954-34-3-Detailed Image 6

    Shop Anti-Wrinkle   Anti-Aging Epitalon Quality Guarantee  After Sales Assure-Detailed Image 6

    Q1:Are you a supplier or a manufacturer?
    A:We are both a supplier and a manufacturer.

    Q2:How will you deliver the goods?
    A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Q3:Which kind of payment terms do you accept?
    A:, Bitcoin, PayPal.USDT.

    Q4:How is the after-sales service?
    A:We will provide high-quality products and ensure 100% safe deliver.

    Q5:how can we guarantee quality?
    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

    Q6: How to confirm the Product Quality before placing orders?
    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

    Q7:Is there any discount?
    A:Yes, for larger quantity, we always support with better price.

    Shop Hot sale Top quality selank Professional-Grade Customizable Options Quality Guarantee After Sales Assured 129954-34-3-Detailed Image 7


    Welcome to be our distinguished customer,please do not hesitate to contact us!

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Shanxi An Da Si Hai Technology Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2025

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.