Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival
154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival buy - large image1
154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival buy - image1
154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival buy - image2
154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival buy - image3
154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival buy - image4
154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival buy - image5
154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival buy - image6

154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival

TDS 3 Inquiries

Unit Price:

$2/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ShenZhen

Brand:

Tong Peptide

Packaging:

10 vials/box

Price valid (until):

2026-09-11

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name: Tina

    Whatsapp: +852 6576 7865

    Email: tina@tongpeptides.com


    We offer various types of peptides, about peptides, we can offer good quality, good price. Customers who have ordered our products (peptides) have received very good feedback. Reliable buyers around the world can contact us about peptides

    1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

    2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product. We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides. The feedback from customers who have ordered our products (peptides) is very good. Reliable buyers around the world can contact us for peptide matters. We offers an unparalleled combination of quality, performance and value. If you have any questions about this product or want to learn more about how it can benefit your business, please feel free to contact us. We are committed to providing excellent customer service and helping our customers achieve their business goals.We look forward to the opportunity to work with you and help you succeed.


    Store unopened lyophilized powder at ‑20℃, keep dry and away from light. Reconstitute with 0.9% BAC bacteriostatic water. After reconstitution, store at 2‑8℃ refrigeration. Gently swirl the vial to dissolve powder, do not shake violently. Avoid repeated freeze‑thaw cycles, aliquot is recommended for dissolved peptide solution.Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 1
    Items Specifications
    Product Name LL-37 /375--10mg*10 vials
    Appearance White Lyophilized Powder
    Purity ≥99%
    CAS No. 154947-66-7
    Storage (Unopened) -20℃, Keep dry and away from light
    Storage (After reconstitution) 2-8℃ refrigerated, use within 7-12 days
    Solvent for reconstitution

    BAC water (Benzyl Alcohol 0.9%)

    Shelf life 3 Years
    MOQ 1 box(10 vials)
    • Why choose us?
    • Our Services

      1.Strictly control the process from raw materials to finished products.

      2.Customer first, we provide reasonable price, high quality products and timely delivery.

      3.Our delivery method is safe and fast.

      4.Quickly and clearly answer customer 's questions.

      If you place a large number of orders with us, we can give a price discount.Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 2 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 3 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 4 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 5

    We accept Alibaba,Bitcoin,Bank and USDT payments.

    Orders placed on the same day will be shipped the next day.

    FAQ

    1.Do you ship internationally?

    Worldwide shipping options may be available depending on destination, product category, and local import rules. Please confirm your country with our team first.

    2.How should customers confirm legality?

    Customers are responsible for confirming that import, possession, research use, or any other intended use is lawful in their jurisdiction before requesting shipment.

    3.Can I request COA before confirming details?

    Yes. You can request available batch documentation, product information, and shipping details through WhatsApp before you confirm the order request.

    Super fast delivery and receipt time,only five or six daysShop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 6 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 7

    All our peptides are e with certified high purity, reliable stable quality that cheap suppliers can’t match.
    We take full responsibility for customs clearance to avoid detention troubles for you.

    1. We are the source factory of materials, offering high quality and high purity with wholesale prices.
    2. We can deliver to any region, with dedicated delivery services, ensuring safety and speed.
    3. You can communicate with us for any product. Our products are diverse and we support customization to meet your needs as much as possible.
    4. We support various payment methods, and all details can be discussed.
    5. You can contact me for any questions. I will do my best to answer them for you.

    6 Price : We do not engagein price wars. Our first quotation may too expensive to you, please don't lose heart. Firstly, our quality can be guaranteed; Secondly, our tranportation efficiency and custome clearance rate can be guaranteed; Thirdly, we will provide you with the highest quality service, in any aspect.

    You get what you pay off, if you have any questions, i will have the answer.Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 8 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 9

    Our company is a high-tech enterprise specializing in the research, production and sales of peptide products. With advanced laboratories and strict quality control systems, our products have obtained international certifications, ensuring safety and effectiveness.
    Our customers are located in Europe, the United States, Southeast Asia, the Middle East and other regions.

    Biotechnology Co., Ltd. is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. With advanced laboratories and a rigorous quality control system, our products have obtained international certification, ensuring safety and efficacy.

    As a global trading company, we provide customized solutions for customers in Europe, the United States, Southeast Asia, the Middle East and many other regions. Adhering to the concept of "Technology leads to health", we are committed to innovation and strive to provide high-quality health products for global consumers.
    Business philosophy
    Based on the domestic market, we have increased investment in research and development, produced high-quality products, and promoted environmental protection and sustainable development through technology. At the same time, we actively expand the international market, sincerely serve society, and strive to become a modern, environmentally friendly, and advanced technology enterprise with global standards. Contact Us

    Our products have been exported to 130 countries and regions. We are committed to establishing stable, strategic and long-term partnerships with both domestic and international suppliers and customers, working together to create a brighter future.Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 10 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 11 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 12

    Our advantage: Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.
    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales workShop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 13 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 14 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 15 Shop 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival-Detailed Image 16

      How to make an order?

    Send me message and let me know what you need with quantity , then i will calculate to you.


    WhatsApp+852 6576 7865

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • 154947-66-7 375 LL37|Factory Direct Supply|High >99% Purity|Fast Shipping|Customs Clearance|On Time Arrival Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.