 Home > Biochemical Engineering > Polypeptide > Teriparatide acetate for Sale > Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder

Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder buy - large image1

Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder buy - image1

Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder buy - image2

Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder buy - image3

Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder buy - image4

Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder

Name: Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder
Brand: Runlian or as clients' requirement
SKU: pr2601071162
Price: 90 USD
Availability: InStock

TDS 18 Inquiries

Unit Price:

$90-110/G FOB

Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

shenzhen

Brand:

Runlian or as clients' requirement

Packaging:

5ml,10ml,15ml,20ml,30ml,40ml,50ml,60ml/vail,10vails/box or as clients' requirement

Sample Available:

Yes

Price valid (until):

2026-12-30

Contact Supplier

 Chat Now

Runlian peptide supplier

Company Type:

Trader

Location:

China

Average Lead Time:

15 days

Qualification:

Main Products:

Peptide,retatrutide,Semaglutide

 Visit Store

Product Details
Seller Information
Inquiry History

Description

Product Detail

Specialized in Providing High-quality Bioactive Peptides

We specialize in providing high-quality bioactive peptides and premium fitness supplements to global markets. Our products are designed to meet the needs of health-conscious consumers, brands, and distributors who are seeking safe and effective ingredients.

We provide the raw materials for the following products. Please contact us if you have any needs.

PRODUCT NAME:	CAS NO.
Atosiban Acetate	90779-69-4
Eptifibatide	188627-80-7
Terlipressin Acetate	14636-12-5
Oxytocin	50-56-6
Somatostatin	51110-01-1
Octreotide Acetate	83150-76-9
Thymalfasin	69440-99-9（62304-98-7）
Carbetocin	37025-55-1
Ganirelix Acetate	123246-29-7
Cetrorlix Acetate	120287-85-6
Teriparatide	52232-67-4
Tirzepatide	2023788-19-2
Sermaglutide	910463-68-2
Bivalirudin	128270-60-0

Items	Specifications
Product Name	Peptide
Purity	>99.0%
Appearance	White Lyophilized powder or others
Reconstitution	Required
Storage	After reconstitution store at 2°C - 8°C, well-closed containers
MOQ	1 box
Package	10 vials per box
Payment term	Alipay,Bitcoin,USDT,T/T, WU
Delivery time	Within 3 Working Days Payment
Advantage	Door to door,Clearance,100% safe delivery to your hands,By air receive them about 5-10days

Shipping and packages

Shipping Cost: Special Shipping Line, delivery time 12-15 days
USPS(to America), delivery time 10-12 days
DHL/UPS/Fedex(Worldwild), delivery time 5-7 days
Forwarder informs that due to the increased customs inspection and the increased difficulty of customs clearance, the logistics costs have increased. We have to make changes to the delivery clause. Once the logistics situation changes, we will update it as soon as possible. We hope you can understand.

Shop Weightloss peptide Tirzepatide Retatrutide AOD NAD BPC TB 5mg 10mg peptide vials-Detailed Image 14

Goods quality:

1.Product has COA, and HPLC testing report
2.Our factory is ISO9001 standard
3.We have the great reviews from customers

OEM service:

1.Customized logo
2.Customized label, packing box as customer's requirement
3.Cap color can be customized

Shipping service:

1.Goods shipped in 1-3 days after payment.
2.Shipping fast and safe in about 5-10 days
3.We can do special packing
4.Tracking number is offered after ordering

Door to door,Clearance,100% safe delivery to your hands

If there is any problem in transportation, we are willing to bear all costs,

FAQ

Q: How to order this product?
A:You can send us your Purchase order(if your company has), or just send a simple confirmation by email or message, we will send you order confirmation, then you can make your order accordingly.

Q: How long can I receive my ordered goods?
A: We ship by special line shipping door to door; you can receive it in about 8-15 days.

Q: What's your MOQ?
A:For the regular products, our MOQ is 1box; For other customized products, our MOQ starts from 10boxes to 50boxes.

Q: Is there a discount?
A: Yes, for larger quantity order, we always support with better price.

Q: How to store it?
A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

Q: Are you manufacturer or trading company?
A: We are manufacturer for over 8 years now, peptides are our main product, and we also develop others, such as raw powders, nootropics, plant extracts, etc.

Shop Weightloss peptide Tirzepatide Retatrutide AOD NAD BPC TB 5mg 10mg peptide vials-Detailed Image 16

Shop Weightloss peptide Tirzepatide Retatrutide AOD NAD BPC TB 5mg 10mg peptide vials-Detailed Image 17

Shop Weightloss peptide Tirzepatide Retatrutide AOD NAD BPC TB 5mg 10mg peptide vials-Detailed Image 18

Shop Weightloss peptide Tirzepatide Retatrutide AOD NAD BPC TB 5mg 10mg peptide vials-Detailed Image 19

Company Profile
Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

Customer feedback

ECHEMI Editorial Reference

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.

Research & Reference Note

Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Polypeptide

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Peptide,retatrutide,Semaglutide

Location:
Room 2008, 20th Floor, Unit 2, Building 15, No. 152, Dongsanmalu, Guancheng Hui District, Zhengzhou City, Henan Province

Average lead Time:
15 days

Total Annual Revenue:
Less than $1 million

Total Employees:
11-50

Year of Establishment:
2024

Company Profile

About Us
We have been a professional peptide product manufacturer and have overseas warehouses in the United States, Canada and Australia, which are shipped on the same day. Our products are exported to the United States, Canada, Mexico, Australia, the Netherlands, Germany, and other countries. Equipped with state-of-the-art laboratory facilities and cutting-edge production technologies, we uphold the principle of "Quality Primacy" and the philosophy of "Customer Sovereignty" in developing superior biological solutions.

OEM/ODM Services Available
Our core competitiveness is rooted in a production system certified by both GMP and ISO. We ensure that our products meet international standards through full-process quality control management. Moreover, by relying on our scientific research and development system, we achieve optimal efficiency in production output. In response to the demands of brand customers, we have specially developed tailored production solutions. Through the OEM/ODM service model, we provide personalized product development plans for our brand enterprises.

Service Assurance Protocol
We pledge to ensure the secure transit of client consignments with guaranteed delivery precision. Should any shipment discrepancy occur, our comprehensive compensation policy ensures 100% value reimbursement, coupled with expedited replacement arrangements within 8 business hours.

Win-win Cooperation
We cordially invite global partners to witness firsthand how biotechnology is revolutionizing the beauty and wellness industries. At RUNLIAN, every molecular formula embodies the ingenuity of intelligent manufacturing, and every collaboration initiates a new chapter of mutual success. As our founder emphasizes, "We bridge dreams with reality through science, demonstrating China's biotechnological prowess to the world."

Inquiry History

18 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
United Kingdom	Supply	1	Mar 5, 2024
Russia	Teriparatide	1 G	Sep 12, 2026
Russia	Teriparatide	1 G	Sep 12, 2026
United States	Teriparatide kit of 10 2mg vials	1 MT	Sep 7, 2026
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
United States	Teriparatide acetate	1 G	Oct 23, 2026
Peru	Teriparatide acetate	2 MT	Oct 20, 2026
United States	Teriparatide acetate	3 MT	Oct 16, 2026
United States	teriparatide	1 G	Sep 6, 2026
Belgium	Erdafitinib	10 G	Sep 20, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Splenopentin	Industrial Grade/99	$10-13/G FOB	Hantong Kuntai Biological Technology Co., LTD	Inquiry
Teriparatide cas52232-67-4 high purity 99% peptide for osteoporosis	Pharmaceutical Grade/99	$1/G FOB		Inquiry
Teriparatide 99%Freeze-dried powder In stock Minimum Order Hot Selling	Pharmaceutical Grade/99.9	$150-175/UNIT FOB	Yiwu Weitai Trading Co., LTD	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Hot Selling High Quality Teriparatide CAS NO 52232-67-4 TER10	Pharmaceutical Grade/99	$125/MT FOB	Shengyufan International Trade Co., Ltd.	Inquiry

Raw material peptides wholesale price cas :52232-67-4 raw material Teriparatide peptide powder

Product Details

Seller Information