Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

TDS 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

HK

Brand:

GS

Packaging:

10mg*10vials

Price valid (until):

2026-02-09

Company Type:
Trader
Location:
China
Qualification:
Main Products:

beaty prodt

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name: Candice

    Whatsapp: +8 52   61859189

    Email: guangsheng 1 @zgguangsheng.com

    Retatrutide   and More – High-Quality & Competitive Prices!

    I f u need , plz contact me!


    Shop LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 1
    Shop LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 2

    Retatrutide —developed by pharmaceutical giant Eli Lilly and alternatively known as GGG Tri-agonist, GLP-1/GIP/glucagon tri-agonist, or LY3437943—is an injectable breakthrough poised for FDA approval, with significant potential to treat obesity and diabetes. While it shares similarities with established weight loss therapies like tirzepatide and semaglutide, retatrutide delivers enhanced efficacy. When paired with balanced nutrition, consistent physical activity, and healthy lifestyle adjustments, it not only amplifies weight loss results but also addresses obesity-related comorbidities such as diabetes and hypertension (high blood pressure).

    What sets retatrutide apart from other weight loss medications is its superior effectiveness, driven by three key therapeutic mechanisms:

    **Gastric Inhibitory Polypeptide Receptor (GIPR) Agonism: By activating GIP receptors, retatrutide strengthens appetite control, blocks fat storage, reduces caloric intake, and boosts energy expenditure.
    **Glucagon-Like Peptide 1 Receptor (GLP-1R) Agonism: It supports weight reduction by improving glycemic control—stimulating pancreatic insulin secretion while curbing the release of glucagon, a hormone that elevates blood sugar levels.
    **Glucagon Receptor (GR) Agonism**: Retatrutide further regulates blood glucose by suppressing glucagon release, diminishes food cravings, and increases energy burn, all of which contribute to meaningful weight loss.

    Products Name : Retatrutide
    Trade Name : LY-3437943
    CAS No. :2381089-83-2
    Molecular Formula : C221H342N46O68
    Molecular Weight : 4731.33g/mol
    Sequence:Tyr-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{ α-Me-Leu}-Leu-Asp-Lys-{diacid-C20-gamma-Glu-(AEEA)-Lys}-Ala-Gln-{Aib}-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
    Appearance : White Lyophilized powder
    Reconstitution:  Required 
    Storage : After reconstitution store at 2°C - 8°C

    BENEFITS OF GLP-1 AGONISTS

    • Slows gastric emptying to prolong feelings of fullness
    • Suppresses excessive hepatic glucose production (prevents the liver from overproducing sugar)
    • Stimulates pancreatic insulin secretion in response to elevated blood glucose levels
    • Aids in glycemic control and blood sugar regulation
    • Alleviates hyperglycemia, particularly postprandial (after-meal) spikes
    • Reduces fasting insulin concentrations and fasting blood glucose levels
    • Lowers hemoglobin A1c (HbA1c) to improve long-term glycemic outcomes
    • Curbs appetite and reduces caloric consumption, while counteracting weight gain
    • Demonstrates efficacy in lowering triglyceride levels and mitigating oxidative stress associated with high LDL ("bad" cholesterol)
    • Promotes weight loss in obese patients when administered at higher dosages
    • Decreases leptin levels and enhances leptin sensitivity (improving the body’s ability to regulate hunger and metabolism)

    Facilitates the browning of white adipose tissue (converts energy-storing white fat to energy-burning brown fat)


      Product Detail  


    Pls input...

    Shop LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 3
    Shop LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 4

    4. Our advantage

    1. Own your own chemical plant

    2. Rich professional production experience

    3. Sample free and in stock, delivery

    4. Price, quality and service, we care about all your concerns

    5. Timely reply Keep in touch to save your time

    6. Easy customs clearance, we have all these controlsAll very good

    7. Dedicated researchers customize it for you.

    Peptide Storage Guidelines: General Tips
    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
     Aliquot peptide according to experimental requirements



    Shop LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 5
    Shop LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 6


      Product Detail  


    Company profile

    Guangsheng Technology Co., Ltd. We strive for survival, innovation and development through quality. We adhere to the business philosophy of honesty and trustworthiness, uphold the quality policy of "all based on quality standards, with customer satisfaction as the goal, pursuing novelty and people-oriented quality", and continuously improve and perfect ourselves. We are the developers and leaders of green active materials. Professional product production, product transportation and professional team services have enabled us to gain a good reputation worldwide.

     

     

    service:

    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;  
    2. We will reply you for your inquiry in 24 hours;  
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery .


    Shop LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 7
    Shop LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 8
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 | US Warehouse | CHINA factory | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    beaty prodt

    Location:

    Yongtai Jinli City Plaza, Baiyun District, Guangzhou City, Guangdong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    30

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2023

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.