 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale buy - large image1

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale buy - image1

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale buy - image2

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale buy - image3

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale buy - image4

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale

TDS 1 Inquiries

Unit Price: Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

Packaging:

5mg per vial;10vial/box

Price valid (until):

2026-04-06

Contact Supplier

 Chat Now

LingMi BioTechnology Co., Ltd

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Peptides

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

we sale full list with peptide products , any other requirements just contact me!

Name:zoe

email: 937837975@qq.com

WhatsApp: +852 53739603

Description:

Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

we specialize in weight loss packages for anyone looking for a total body transformation using a customized peptide package that is tailored just for your body. Our peptides have been around for decades but only to cater to the rich and famous. But now, we have brought their successful, customized treatments to the general public. Patients begin to see results and feel the effects in as quick as three weeks, transforming their bodies and feeling stronger and more energetic. Let us help you get your edge back.

This program covers everything from fat loss to introductory muscle building. If you have struggled to get weight off and keep it off, this may be a great option for you!
Application:

1. LL37 has been used as an antimicrobial agent to improve wound healing.

2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

Items	Specifications
Items	Specifications
CAS RN	154947-66-7
Appearance	White Powder
Purity	99%
Storage condition	-20℃

Application:

1. LL37 has been used as an antimicrobial agent to improve wound healing.

2. LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

3. LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

4. LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

5. LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

6. LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.

Advantage

Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale-Detailed Image 6

Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale-Detailed Image 7

Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale-Detailed Image 8

1. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

2.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

3.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

Why Choose US

• High Purity (≥98%) – Strictly tested, consistent quality.
• Flexible Packaging Options – 10mg/vial, bulk available.
• Trusted by Global Buyers – Stable supply, fast delivery.

FAQ

Q1:How to send order?
A:Send order list to us,we quote best price for you,then ship package out and offer tracking nubmer to you after payment send.

Q2:Do you have samples for our reference?
A:Sure,we can offer smaples,the customers will pay the freight.

Q3:Any discount if order more?
A:Sure,the price is negotiable,you can get much better price if order big quantity.

Q4:What about the delivery time?
A:Ship within 1-2 days after confirming payment (excluding Chinese holidays).5-10 working days to arrive your address.

Q5:What kind of payment terms do you accept?
A:Payment can be made by Bank transfer, BTC,Credite Card,TT,Paypal,Alipay,Wechat,Visa,Mastercard,Appple Pay,Goolge Pay.

Packing and shipping

Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale-Detailed Image 9

Shop LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale-Detailed Image 10

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
Peptides

Location:
Jinxing Middle Road, Xihu Street, Yuelu District, Changsha City, Hunan Province

Payment Terms:
TT against copy of documents,D/P,L/C,100% TT in advance

Average lead Time:
1

Total Annual Revenue:
Less than $1 million

Total Employees:
11-50

Year of Establishment:
2023

Certifications:
COA

Company Profile

Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

Inquiry History

1 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 high purity 99% freeze dried powder cas154947-66-7 senwayer hot sales	Pharmaceutical Grade/99	$85/MT FOB	Changsha Caoquan	Inquiry
RT30 RT40 RT50 RT60 BC5 BC10 BC20 BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 GT600(Brand) GT1500 CGL5	Pharmaceutical Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry

LL37 99% purity 5 milligrams of peptide powder CAS 154947-66-7 Factory direct sale

Product Description

Seller Information

Inquiry History

CAS RN

Appearance

White Powder

Purity

99%

Storage condition

More Choices Find All Products for Sale 

Related Searches