Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Teriparatide acetate for Sale > High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg
High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg buy - large image1
High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg buy - image1
High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg buy - image2
High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg buy - image3
High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg buy - image4
High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg buy - image5
High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg buy - image6

High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg

14 Inquiries

Unit Price:

$10/UNIT FOB

Get Latest Price
CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

qingdao

Brand:

China

Packaging:

0.05kg

Price valid (until):

2029-12-31

Company Type:
Trader
Location:
China
Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description




     

       Ktechpeptide 

     


    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 1

    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:


    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 


    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 


    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 2 Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 3 Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 4 Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 5

    Why Choose Our Peptides?

    • Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .
    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .

    Key Search Terms:

    Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom peptides formulations, GLP-1 related peptides, injectable peptide for weight management, peptide supplements for metabolic health
    Customizable peptide
    Skin care peptide
    Beauty peptide
    Muscle building peptide
    Hair growth peptide
    Weight loss peptide
    Fitness peptide

    Shop High Quality Factory Price Supplement MT-2 Peptides Powder-Detailed Image 6


    Payment

    We accept payment methods such as T/T, D/P, Paypal and Money Gram.

    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 6


    Packing & Delivery

    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 7 Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 8 Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 9

    As a professional supplier of weight loss peptides, we provide high-quality products and integrated services to medical institutions, health management organizations, and individual users through a global supply chain network and compliant operation system.


    All our peptide products(wholesale Peptides 99.9% Purity) boast a purity of ≥99% with third-party test reports, sourced from GMP-certified manufacturing partners and produced in line with international standards such as FDA DMF filing requirements.


    Coperations are certified by ISO 9001, with some products holding WHO prequalification;  every batch undergoes strict quality inspections (HPLC purity testing, microbial limit analysis, etc.) to guarantee full traceability.


    Committed to cost-effectiveness and sustainability, we eliminate middlemen to offer products 30-50% more affordable than originators, while promoting green production practices and strict compliance with global pharmaceutical regulations.


    Shop Factory Wholesale Super Collagen Protein Peptide Powder AHK-Cu Hyaluronic Acid Vitamin C Supplement For Beauty Skin And Anti-Aging-Detailed Image 10


    FAQ

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future


    Q2: Do you have stock?

    A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.


    Q3: How do I start paying?

    Payment can be made by Bitcoin,wire transfer or paypal


    Q4: How to confirm product quality before placing an order?

    A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

    You can send us your product specifications and requirements and we can customize for you.


    Q5: What is your MOQ?

    A: The minimum quantity we can order is 1 box.

    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.


    Q6: Time for delivery?

    A: Leading time within 3 business days,Shipping time about 8-10 business days. 


    Q7: Why should I choose you?

    A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.

    Pls input...

    Items Specifications
    Apperance Powder
    Key words snap-8
    Function Anti-aging
    ECHEMI Editorial Reference
    The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
    Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
    Parathyroid Hormone Human Synthetic (C181H291N55O51S2) contains 34 amino acids and has a molecular mass of 4117.72 Dalton.The PTH is purified by proprietary chromatographic techniques.
    Research & Reference Note

    High Grade Peptide Powder CAS Teriparatide Acetate Blend Peptide Vials 10mg is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    Teriparatide acetate

    Other Name:

    PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

    CAS No.:

    52232-67-4

    Molecular Formula:

    C172H278N52O47S2

    InChIKeys:

    BUUKFBVDKSFMHN-LKMAISLMSA-N

    Molecular Weight:

    3890.49792

    EC Number:

    640-978-1

    Color/Form:

    White to Off-White

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    Melting Point:

    >205oC (dec.)

    Water Solubility:

    Soluble to 0.40 mg/ml in water

    Critical Temperature & Pressure:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Carcinogenicity, Category 2

    Reproductive toxicity, Category 2

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Warning

    Hazard statement(s)

    H351 Suspected of causing cancer

    H361 Suspected of damaging fertility or the unborn child

    Precautionary statement(s)
    Prevention

    P203 Obtain, read and follow all safety instructions before use.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    Response

    P318 IF exposed or concerned, get medical advice.

    Storage

    P405 Store locked up.

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 1001, Unit 2, Building 30, Xing'an Community, Dongcheng Street, Ancheng Town, Pingyin District, Jinan City, Shandong Province,China

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2022


      Company Profile  


    Ktechpeptide Company, founded in 2022, stands out with robust research and development strength, top-tier synthesis techniques, and state-of-the-art quality assurance protocols. We proactively pursue strategic alliances and collaborative projects with leading enterprises and manufacturers globally, driven by an industrial development ethos dedicated to serving society and delivering value to our customers. Guided by market needs, we continuously innovate and synthesize cutting-edge high-tech chemical products and pharmaceutical intermediates. With rich experience in international trade, our products are mainly exported to markets including the United States, Europe, India, South Africa, and Nigeria. We ensure safe and reliable logistics, enabling every client to receive their shipments securely and promptly.

  • Inquiry History
    14 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    Teriparatide

    1 KG May 28, 2026
    United States

    teriparatide

    1 G Sep 6, 2026
    Russia

    teriparatide

    100 MG Feb 23, 2026
    Kazakstan

    Teriparatide

    1 KG Jan 4, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 1, 2026
    Kazakstan

    teriparatide

    1 KG Nov 17, 2025
    United States

    Teriparatide

    10 MT May 29, 2026
    Bulgaria

    teripatatide

    May 17, 2026
    Kazakstan

    Teriparatide

    5 MG Jan 2, 2026
    United Kingdom

    Supply

    Mar 5, 2024
    Russia

    Teriparatide

    1 G Sep 12, 2026
    Russia

    Teriparatide

    1 G Sep 12, 2026
    United States

    Teriparatide kit of 10 2mg vials

    1 MT Sep 7, 2026
    Germany

    Teriparatide Acetate

    5 MG Jul 5, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.