LL-37 CAS 154947-66-7 Factory wholesale and direct sale White powder Raw material peptide Weight reduction.

• • • .

    • LL 37 peptide, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide.LL 37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. CAP-18 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes

      Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.

      
      

      The human body mainly produces two types of antimicrobial peptides: defensin family peptides and cathelicidin family peptides. Although there are many members of the defensin family of peptides, cathelicidin has only one antimicrobial peptide product, LL-37. LL-37 is the C-terminal cleavage product of cathelicidin peptide Hcap-18, which directly kills bacteria, fungi and viruses.

      
      

      	Sequence : [LL-37, 37 aa]
      	MW : 4 493.4 Da (C205H340N60O53)
      	Purity : > 99%
      	Other names : Cathelicidin,154947-66-7, All38 peptide, BAC4, CAP18, CAMP,
      	Peptide Solubility Guideline
      	Bulk peptide quantities available

      
      

      What is the Benefit of LI 37 Peptide?

      1. Immune Support
      2. Antimicrobial Properties
      3. Wound Healing
      4. Anti-inflammatory Effects
      5. Angiogenesis Promotion 
      6. Anti-tumor Potential
      7. Skin Health
      8. Neuroprotective Effects

Jinan Zhiwen Xinsheng Electric Technology Co., Ltd. Was established in 2009. It mainly deals in peptide products, synthetic peptide amino acids, beauty and slimming products, and beauty freckle removal cosmetic raw materials. It has strong R&D capabilities, superb synthesis technology, and advanced quality control methods. It effectively promotes joint ventures with major companies and manufacturers, and serves the society and users with the concept of industrial development. It always adheres to market demand-oriented, continuously synthesizing new high-tech freckle and wrinkle removal beauty peptide products, which are mainly exported to the United States, Europe, South Africa, Nigeria and other countries and regions. It has rich export experience and ensures transportation safety. 

Which payment is available for your company?

Bank Transfer,Paypal or Bitcoins usdt trc usdt erc and so on.  You can choose the way which is convenient for you.

May I get one sample before placing order?

Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.Mutual effort towards each other.

Why should you buy from us not from other suppliers?

1. Powerful R & D team
2. The ability of quantized production from grams to tons;
3. Various kinds of advanced equipment in the laboratory and plant;
4 .Strict QC standard to meet the demand of customers, advanced equipment for analysis and assay;
5. Efficient and safe logistic plans for chemical products transportation;
6 .Excellent after-sale service.
7. Highest quality and good package