Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > freeze dried powder cas154947-66-7 LL37 high purity and High Quality 99% Purity
freeze dried powder cas154947-66-7 LL37  high purity and High Quality 99% Purity buy - large image1
freeze dried powder cas154947-66-7 LL37  high purity and High Quality 99% Purity buy - image1
freeze dried powder cas154947-66-7 LL37  high purity and High Quality 99% Purity buy - image2
freeze dried powder cas154947-66-7 LL37  high purity and High Quality 99% Purity buy - image3
freeze dried powder cas154947-66-7 LL37  high purity and High Quality 99% Purity buy - image4
freeze dried powder cas154947-66-7 LL37  high purity and High Quality 99% Purity buy - image5
freeze dried powder cas154947-66-7 LL37  high purity and High Quality 99% Purity buy - image6

freeze dried powder cas154947-66-7 LL37 high purity and High Quality 99% Purity

TDS 3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

MeiL

Packaging:

10 vails/kit

Price valid (until):

2026-06-28

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Reta, Tirz, Sema, Cosmetic Products

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Name:Coco

    Whatsapp:+852 6935 9468

    Email:coco@meilipep.com


      Product Detail  



    Shop freeze dried powder cas154947-66-7 LL37  high purity and High Quality 99% Purity-Detailed Image 1

    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.

    Ll-37 , Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    These products are APIs (Active Pharmaceutical Ingredient) and not a finished drug. 

    It is intended strictly for research and laboratory use only.

    Buyers are required to fully comply with all applicable laws and regulations regarding the handling and use of this material.


    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirement


      Product Introduction  



    Product Name Best LL37 stock source
    Purity ≥99%
    Appearance  Lyophilized Powder
    MOQ 1kit(10 Vials)
    Origin China
    Small Order Accepted
    Brand Name MeiL
    Usage Cosmetic Raw Materials
    Package 10 Vials per box

    Peptides are chains of amino acids produced in every cell of the body that help form the building blocks of basic proteins such as collagen and elastin, which contribute to the structure, strength, firmness, and smoothness of hair, skin, and nails.

    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 2

    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 3

    Shop Factory spot direct price TB500  CAS-885340-08-9 Thymosin B4 Acetate Janoshik Tested (DDP Method)-Detailed Image 4


      Company Introduction  


    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 5

    Mei Li is a professional company specializing in the production of beauty products, healthy products. Mei Li is dedicated to providing the highest standards of product quality and safety compliance.

    We closely monitor our customer's compliance programs and adhere to international laws and regulations, including those of the U.S. and Europe. We recognize the challenges posed by geographic distance, language barriers, cultural differences, and the need for on-site quality control and inspection. Hence, we strive to mitigate these challenges, ensuring a seamless and reliable sourcing experience from us.

    Choosing us ,you will have a reliable partner, best quality products ,fast and safe delivery ,and worry-free after- sales experience. Sincerely hope that we can have long term cooperative relations with our customers and achieve a win-win situation.


      Customer's Feedback


    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 6

    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 7


      Shipping Record  


    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 8

     Who We Serve

    -We proudly work with clients across North America, Europe, Asia, and Latin America, including:

    -Biotech and pharma firms

    -Research institutions & universities

    -Peptide formulation startups

    -CDMOs and CRO partners


      Product Delivery   


    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 9


    F A Q  


    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 10

    Q: How to order this product?

    A:You can send us your Purchase order, or just send a simple confirmation by email or message, we will send you order confirmation, then you can make your order accordingly.

    Q: How long can I receive my ordered goods?

    A: Door to door service , you can receive it in about 8-15 days.

    Q: What's your MOQ?

    A:For the regular products, our MOQ is 1box.

    Q: Is there a discount?

    A: Yes, bulk order with big discount.

    Q:About the after-sale service?

    A:After purchasing the products from our Company, we have a professional technical team and after-sales team to serve you and solve all your problems in the future.


      Payment 


    We support a variety of payment methods, choose the most convenient for you .

    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 11


      Our advantages  


    Safe & Fast & Best Quality

    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 12 Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 13



      Our Service  


    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;  
    2. We will reply you for your inquiry in 24 hours;  
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery .

    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 14


      Others


    If you couldn't find the product you want in our store, maybe we haven't uploaded the complete product, please feel free to contact us through various ways; if you want to customize and process the   product you want, please feel free to contact us for more details too. 

    lf you have any questions or suggestions about the use, function, content, specifications, standards, properties, quotations, market

    conditions and application prospects of the product, please contact us, we will give you a detailed answer.

    Shop Weight loss peptides Retatrutide RETA Reta reta China factory Wholesales price Lyopilized Powder peptide Peptides-Detailed Image 15
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Reta, Tirz, Sema, Cosmetic Products

    Location:

    Guangzhou Yuexiu Strict NongLin Road NO. 81

    Total Employees:

    11-50

    Year of Establishment:

    2026

    MeiLi Biotechnology Co. Ltd is a professional company specializing in the production of beauty products, healthy products. MeiLi is dedicated to providing the highest standards of product quality and safety compliance to customers.

    We closely monitor our customer's compliance programs and adhere to international laws and regulations, including those of the U.S. and Europe. We recognize the challenges posed by geographic distance, language barriers, cultural differences, and the need for on-site quality control and inspection. Hence, we strive to mitigate these challenges, ensuring a seamless and reliable sourcing experience from us.

    Choosing us, you will have a reliable partner, best quality products, fast and safe delivery, and worry-free after- sales experience. Sincerely hope that we could have long term cooperative relations with our customers and achieve a win-win situation.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.