Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LONG R3 IGF-I RECOMBINANT ANALOG for Sale > IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1
IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - large image1
IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image1
IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image2
IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image3
IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image4
IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image5
IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image6

IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1

TDS 2 Inquiries

Unit Price:

$190-200/UNIT FOB

Get Latest Price
CAS No.:

143045-27-6

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangdong

Brand:

EnShi

Packaging:

1mg*10vials

Price valid (until):

2029-01-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

       Name :Leona

    Whatsapp/wechat:+852 96816401

    Email:sjzes4@enshikj.com

    What is IGF-1LR3 ?                                                         

    • IGF-1 LR3 (Long Arginine 3-Insulin-like Growth Factor 1), also known as Long R3 IGF-1 or LR3-IGF-1, is a recombinant synthetic analog of human insulin-like growth factor 1 (IGF-1) . It differs from native IGF-1 in two key structural modifications: an arginine substitution for glutamic acid at position 3 ("R3") and an additional 13-amino acid extension at the N-terminus ("Long"), resulting in a total of 83 amino acids compared to the 70 amino acids of native IGF-1 .

      These modifications dramatically reduce its binding affinity for insulin-like growth factor-binding proteins (IGFBPs) by approximately 500-fold, significantly extending its plasma half-life to 20-30 hours and increasing its bioavailability and biological potency by about 3 times compared to native IGF-1 . This research-grade peptide is produced using advanced recombinant DNA technology and purified to ≥99% by high-performance liquid chromatography (HPLC) .

    • Shop Factory direct sales of high-quality Thymalin white powder peptide 10mg Immune regulation tissue repair Best price-Detailed Image 2
    • Research Applications:                                                  

    • IGF-1 LR3 is exclusively intended for in vitro and in vivo laboratory research use only. Its primary research applications include:

      • Cell culture and cell biology studies (especially for mammalian cell lines)
      • Skeletal muscle growth, hypertrophy, and regeneration research
      • Metabolic regulation and insulin sensitivity studies
      • Tissue engineering and regenerative medicine research
      • Bone and cartilage development and fracture healing studies
      • Cancer biology research (investigation of IGF-1R-mediated signaling pathways)
      • Neurobiology and neuronal survival research
      • Preclinical pharmacology and drug development studies



    • Shop Factory Supply LL 37 CAS 154947-66-7 High quality LL-37 peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 3 Shop IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1-Detailed Image 3

      Lyophilization Technology Advantages:                      

    • Our IGF-1LR3 undergoes state-of-the-art freeze-drying process that delivers unmatched benefits:
      1、Maximum Activity Retention: Preserves IGF-1LR3's native structure and biological activity by avoiding thermal degradation
      2、 Exceptional Stability: Extends shelf life to 24 months when stored properly (vs. 3-6 months for liquid forms)
      • 3、Enhanced Purity: Removes residual solvents and moisture completely, minimizing degradation factors
      • 4、Easy Reconstitution: Dissolves rapidly in sterile water or saline with no clumping
      • 5、Reduced Contamination Risk: Aseptic manufacturing process ensures product safety

      Shop IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1-Detailed Image 4
    • Basic Information:                                                         
    • Product IGF-1LR3
      CAS Numbers 143045-27-6 (primary), 946870-92-4 (common alternative)
      Molecular Formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
      Molecular Weight 9117.60 g/mol
      Amino Acid Sequence MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
      Appearance Fine white lyophilized powder
      Purity ≥99% (HPLC verified)
      Endotoxin Level <0.1 EU/mg
      Storage -20°C for lyophilized powder (stable for 2 years); 4°C for reconstituted solution (up to 7 days); -20°C for reconstituted solution (up to 3 months, aliquoted)

      Shop IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1-Detailed Image 5Company Profile:                                                        
    • EnShi Technology Co., Ltd is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. With years of experience in the pharmaceutical chemical and biosynthetic industries.It provides compliant, stable and cost-effective core raw materials as well as one-stop CDMO/CMO solutions for global pharmaceutical enterprises and innovative drug R&D institutions.

    Shop Factory Supply LL 37 CAS 154947-66-7 High quality LL-37 peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 7 Shop IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1-Detailed Image 7 Shop IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1-Detailed Image 8

    Packing:                                                                       

    Shop Factory direct sales of high-quality Thymalin white powder peptide 10mg Immune regulation tissue repair Best price-Detailed Image 9

    Shipping:                                                                     

    Shop Factory direct sales of high-quality Thymalin white powder peptide 10mg Immune regulation tissue repair Best price-Detailed Image 10

    FAQ:                                                                             

    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods ?
    We could accept pay through paypal,bank transfer, XTransfer and bitcoin.


    Certificates

    Basic Info
    Product Name:

    LONG R3 IGF-I RECOMBINANT ANALOG

    Other Name:

    LONG R3 IGF-I RECOMBINANT ANALOG;long R3 igf-I;LONGR3IGF-I MEDIA GRADE;LONG? R3 IGF-I human;rh-IGF-1;LONG R3 IGF-1 (human)

    CAS No.:

    143045-27-6

    Molecular Weight:

    0

    Characteristics
    Critical Temperature & Pressure:

    2-8°C

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 704#-A010, Building 11, Block 16, Liangzhu Street, Yuhang District, Hangzhou City, Zhejiang Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2025

    Certifications:

    Examining report

    Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

  • Inquiry History
    2 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    igf1 lr3

    1 G Jun 4, 2026
    Australia

    IGF-lr3

    100  Dec 22, 2023
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.