 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LONG R3 IGF-I RECOMBINANT ANALOG for Sale > IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1

IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - large image1

IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image1

IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image2

IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image3

IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1 buy - image4

IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1

Name: IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1
Brand: EnShi
SKU: pr2605061316
Price: 190 USD
Availability: InStock

TDS 2 Inquiries

Unit Price:

$190-200/UNIT FOB

Get Latest Price 

CAS No.:

143045-27-6

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangdong

Brand:

EnShi

Packaging:

1mg*10vials

Price valid (until):

2029-01-01

Contact Supplier

 Chat Now

Enshi Technology Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

peptides

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Name :Leona

Whatsapp/wechat:+852 96816401

Email:sjzes4@enshikj.com

What is IGF-1LR3 ?

IGF-1 LR3 (Long Arginine 3-Insulin-like Growth Factor 1), also known as Long R3 IGF-1 or LR3-IGF-1, is a recombinant synthetic analog of human insulin-like growth factor 1 (IGF-1) . It differs from native IGF-1 in two key structural modifications: an arginine substitution for glutamic acid at position 3 ("R3") and an additional 13-amino acid extension at the N-terminus ("Long"), resulting in a total of 83 amino acids compared to the 70 amino acids of native IGF-1 .

These modifications dramatically reduce its binding affinity for insulin-like growth factor-binding proteins (IGFBPs) by approximately 500-fold, significantly extending its plasma half-life to 20-30 hours and increasing its bioavailability and biological potency by about 3 times compared to native IGF-1 . This research-grade peptide is produced using advanced recombinant DNA technology and purified to ≥99% by high-performance liquid chromatography (HPLC) .
Research Applications:
IGF-1 LR3 is exclusively intended for in vitro and in vivo laboratory research use only. Its primary research applications include:
- Cell culture and cell biology studies (especially for mammalian cell lines)
- Skeletal muscle growth, hypertrophy, and regeneration research
- Metabolic regulation and insulin sensitivity studies
- Tissue engineering and regenerative medicine research
- Bone and cartilage development and fracture healing studies
- Cancer biology research (investigation of IGF-1R-mediated signaling pathways)
- Neurobiology and neuronal survival research
- Preclinical pharmacology and drug development studies

Lyophilization Technology Advantages:
Our IGF-1LR3 undergoes state-of-the-art freeze-drying process that delivers unmatched benefits:

1、Maximum Activity Retention: Preserves IGF-1LR3's native structure and biological activity by avoiding thermal degradation

2、 Exceptional Stability: Extends shelf life to 24 months when stored properly (vs. 3-6 months for liquid forms)
- 3、Enhanced Purity: Removes residual solvents and moisture completely, minimizing degradation factors
- 4、Easy Reconstitution: Dissolves rapidly in sterile water or saline with no clumping
- 5、Reduced Contamination Risk: Aseptic manufacturing process ensures product safety
Basic Information:

Product	IGF-1LR3
CAS Numbers	143045-27-6 (primary), 946870-92-4 (common alternative)
Molecular Formula	C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular Weight	9117.60 g/mol
Amino Acid Sequence	MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Appearance	Fine white lyophilized powder
Purity	≥99% (HPLC verified)
Endotoxin Level	<0.1 EU/mg
Storage	-20°C for lyophilized powder (stable for 2 years); 4°C for reconstituted solution (up to 7 days); -20°C for reconstituted solution (up to 3 months, aliquoted)

Company Profile：

EnShi Technology Co., Ltd is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. With years of experience in the pharmaceutical chemical and biosynthetic industries.It provides compliant, stable and cost-effective core raw materials as well as one-stop CDMO/CMO solutions for global pharmaceutical enterprises and innovative drug R&D institutions.

Shop Factory Supply LL 37 CAS 154947-66-7 High quality LL-37 peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 7 Shop IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1-Detailed Image 7

Packing：

Shop Factory direct sales of high-quality Thymalin white powder peptide 10mg Immune regulation tissue repair Best price-Detailed Image 9

Shipping：

Shop Factory direct sales of high-quality Thymalin white powder peptide 10mg Immune regulation tissue repair Best price-Detailed Image 10

FAQ：

1. How to make an order?
Send me message and let me know what you need with quantity , then i will calculate to you

2. What's the lead time and shipping ways?
We will delivery to the package by USPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

3. How do i keep the peptides when i receive it ?
Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

4. What's the payment methods ?
We could accept pay through paypal,bank transfer, XTransfer and bitcoin.

Certificates

Basic Info

Product Name:

LONG R3 IGF-I RECOMBINANT ANALOG

CAS No.:

143045-27-6

Categories:

Bulk Drug Intermediates

Seller Information

Business Type:
Trader

Main Products:
peptides

Location:
Room 704#-A010, Building 11, Block 16, Liangzhu Street, Yuhang District, Hangzhou City, Zhejiang Province

Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
3

Total Annual Revenue:
$1 million-$2.5 million

Total Employees:
5-10

Year of Establishment:
2025

Inquiry History

2 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	igf1 lr3	1 G	Jun 4, 2026
Australia	IGF-lr3	100	Dec 22, 2023

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
igf1 lr3 99% purity Lyophilized powder Wholesales price Safe delivery	Pharmaceutical Grade/99	$5-6/MT FOB	Hangzhou Peijia E-commerce Co., LTD	Inquiry
IG raw material	Pharmaceutical Grade/99.39	$7800/G FOB	Brown Pie Chemical Co., Ltd.	Inquiry
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application	Research Grade/99		Hainan Yinghui Trading Co., Ltd.	Inquiry
IGF-1 LR3 Lyophilized Powder - Long-Acting Biological Activity Guarantee	Pharmaceutical Grade/99.99	$110/UNIT EXW	Jingdezhen Shengtian Tuyuan Trading Co., Ltd.	Inquiry

IGF-1LR3 20-30 Hours Half-Life Low IGFBP Binding 3x Potent Than Native IGF-1

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches