Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LONG R3 IGF-I RECOMBINANT ANALOG for Sale > 99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application buy - large image1
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application buy - image1
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application buy - image2
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application buy - image3
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application buy - image4
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application buy - image5
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application buy - image6

99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application

2 Inquiries

Unit Price: Get Latest Price
CAS No.:

143045-27-6

Grade:

Research Grade

Content:

99%

Port:

HK

Brand:

HNYH

Packaging:

1mg/vial, 10 vials/box

Price valid (until):

2026-06-25

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Shop 99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application-Detailed Image 1
    99% Purity IGF-1 LR3 Research Peptide for Scientific Applications

    IGF-1 LR3 is a synthetic peptide supplied as a sterile lyophilized powder with a purity of ≥99% (tested by HPLC), intended for laboratory and analytical applications. This product is manufactured under strict quality-controlled conditions, ensuring batch-to-batch consistency and reliable analytical performance.
    Each batch undergoes quality verification, including HPLC and Mass Spectrometry analysis, to confirm product purity, consistency, and analytical reliability.
    Key Research Applications: Peptide characterization studies, laboratory analysis, analytical investigations, peptide material evaluation, and research material development.
    CAS Number (for reference only): 143045-27-6
    Molecular Formula: C400H625N111O115S9
    Molecular Weight: 9207.60 g/mol
    Sequence (for reference only): MFPAMPLLSLFVNASSSRGIVDECCFRSCDLRRLEMYCAPLKPAKSA



    Parameter Details
    CAS No. 143045-27-6
    Molecular Formula C400H625N111O115S9
    Molecular Weight 9207.60 g/mol
    Purity (HPLC) ≥99%
    Appearance White to off-white lyophilized powder
    Storage Condition -20°C, protect from light, keep sealed
    Shelf Life 24 months (unopened, at -20°C)
    Sequence {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (Disulfide bridge: Cys3-Cys8)


    Item Specification
    Product Name Cagrilintide Peptide
    CAS No. 143045-27-6
    Molecular Formula C400H625N111O115S9
    Molecular Weight 9207.60 g/mol
    Purity (HPLC) ≥99%
    Appearance White to off-white lyophilized powder
    Dosage Strengths Available 0.1mg, 1mg per vial
    Pack Size 10 vials per box
    Storage Condition -20°C, protect from light, keep sealed
    Shelf Life 24 months (unopened, stored at -20°C)
    Grade Research Grade
    Application For laboratory research use only

    Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 2



    Product Advantages & Applications



    Key Advantag es

    Advantage Description
    🔬 High Purity ≥99% purity by HPLC, COA provided with each batch
    📦 In Stock Regular sizes available in stock, ships within 3-5 business days
    🧪 Strict QC Each batch tested by HPLC and Mass Spectrometry
    🎯 Customization Custom dosage, vial cap color, peptide blends available for bulk orders
    🌍 Global Shipping FedEx/DHL/special line available, free shipping on orders over $1000

    Shop 99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application-Detailed Image 3


    Primary Research Applications

    • GLP-1 receptor agonist mechanism studies

    • Metabolic research and glucose regulation studies

    • Peptide-based drug development and efficacy evaluation

    • Cell signaling pathway research



    Packaging & Shipping


    Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 4 Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 5 Shop Retatrutide Triple Agonist Peptide GIP GLP-1 Glucagon Research Grade 5mg 10mg-Detailed Image 6


      Product Detail  


    Packaging Structure (From Outer to Inner)

    Level Description
    Outer Packaging Standard cardboard box
    Middle Packaging Product box (branded/plain) containing a plastic box inside
    Inner Packaging Plastic box holding 10 glass vials with foam or partition protection
    Vial Clear glass vial, aluminum-plastic flip-off seal, labeled with product name, dosage, and batch number

    Each Plastic Box Contains:

    10 vials of peptide (2mg / 5mg / 10mg / 15mg / 20mg / 30mg per vial, based on your order)

    Each vial is individually sealed with label

    Foam or plastic partition to prevent vials from bumping into each other

    Shipping Methods & Delivery Time

    Shipping Method Cost Delivery Time
    Special Line / Express $40 (under 5kg) ~14 days 


    UK Special Line Same as above ~25 days (slightly delayed)
    UPS / FedEx $70 7-10 days
    Shipping Policies

    Policy Details
    Free Shipping On orders over $1000
    Remote Area Fee Some remote areas may incur an extra $35 (as determined by FedEx/UPS)
    Lead Time 3-5 business days after payment confirmation


    Shop 99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application-Detailed Image 7

    Frequently Asked Questions (FAQ)

    Q1: Can I get a sample before placing an order?

    Yes, samples are available upon request. Samples are not provided for free. You will need to pay for both the sample cost and the shipping fee. The sample fee will be deducted from your bulk order payment once you proceed with a formal order.

    Q2: What payment methods do you accept?

    We accept wire transfer (T/T), PayPal, and bank transfer. You may choose the most convenient method for you.

    Q3: How and when can I receive my order after payment?

    • Small quantity orders: Shipped via international express (DHL, FedEx, UPS, etc.). Delivery time: 7-10 days after shipment.

    • Large quantity orders: Shipped by sea. Delivery time: 15-30 days depending on the destination port.

    • Special line: ~14 days delivery time (under 5kg, $40).

    Q4: Can I use my own label or packaging?

    Yes, OEM service is available for bulk orders. We can customize labels, vial dosage, vial cap color, and packaging according to your requirements. Please contact us for details.

    Q5: What is your MOQ (Minimum Order Quantity)?

    • Retail MOQ: 1 kit/dosage/item

    • Customized packaging (e.g., custom vial size, cap color): 20-50 kits/dosage/item

    Q6: Do you provide a Certificate of Analysis (COA) with each order?

    Yes, each batch comes with a COA (HPLC purity test report). Third-party testing is also available upon request.

    Q7: How should I store the peptide?

    Store at -20°C, protected from light, and keep sealed. Once reconstituted, refrigerate at 2-8°C and use within the recommended timeframe.

    Q8: What documents will be included with my shipment?

    Commercial invoice, packing list, COA, and MSDS will be included with each shipment.


    Research & Reference Note

    99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LONG R3 IGF-I RECOMBINANT ANALOG

    Other Name:

    LONG R3 IGF-I RECOMBINANT ANALOG;long R3 igf-I;LONGR3IGF-I MEDIA GRADE;LONG? R3 IGF-I human;rh-IGF-1;LONG R3 IGF-1 (human)

    CAS No.:

    143045-27-6

    Molecular Weight:

    0

    Characteristics
    Critical Temperature & Pressure:

    2-8°C

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide

    Location:

    Lobby of Area B, Area E, Area F and Area G (Central Office Area), Landao Research Center, No.3 Yingbin Road, Yangpu Economic Development Zone, Hainan Province

    Payment Terms:

    TT against copy of documents,D/P

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Certifications:

    Retatrutide,Retatrutide,Retatrutide,Retatrutide

  • Inquiry History
    2 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    igf1 lr3

    1 G Jun 4, 2026
    Australia

    IGF-lr3

    100  Dec 22, 2023
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.