99% Purity IGF-1 LR3 Research Peptide for Scientific Applications
IGF-1 LR3 is a synthetic peptide supplied as a sterile lyophilized powder with a purity of ≥99% (tested by HPLC), intended for laboratory and analytical applications. This product is manufactured under strict quality-controlled conditions, ensuring batch-to-batch consistency and reliable analytical performance.
Each batch undergoes quality verification, including HPLC and Mass Spectrometry analysis, to confirm product purity, consistency, and analytical reliability.
Key Research Applications: Peptide characterization studies, laboratory analysis, analytical investigations, peptide material evaluation, and research material development.
CAS Number (for reference only): 143045-27-6
Molecular Formula: C400H625N111O115S9
Molecular Weight: 9207.60 g/mol
Sequence (for reference only): MFPAMPLLSLFVNASSSRGIVDECCFRSCDLRRLEMYCAPLKPAKSA
| Parameter | Details |
| CAS No. | 143045-27-6 |
| Molecular Formula | C400H625N111O115S9 |
| Molecular Weight | 9207.60 g/mol |
| Purity (HPLC) | ≥99% |
| Appearance | White to off-white lyophilized powder |
| Storage Condition | -20°C, protect from light, keep sealed |
| Shelf Life | 24 months (unopened, at -20°C) |
| Sequence | {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (Disulfide bridge: Cys3-Cys8) |
| Item | Specification |
| Product Name | Cagrilintide Peptide |
| CAS No. | 143045-27-6 |
| Molecular Formula | C400H625N111O115S9 |
| Molecular Weight | 9207.60 g/mol |
| Purity (HPLC) | ≥99% |
| Appearance | White to off-white lyophilized powder |
| Dosage Strengths Available | 0.1mg, 1mg per vial |
| Pack Size | 10 vials per box |
| Storage Condition | -20°C, protect from light, keep sealed |
| Shelf Life | 24 months (unopened, stored at -20°C) |
| Grade | Research Grade |
| Application | For laboratory research use only |
Product Advantages & Applications
Key Advantag es
Advantage Description
🔬 High Purity ≥99% purity by HPLC, COA provided with each batch
📦 In Stock Regular sizes available in stock, ships within 3-5 business days
🧪 Strict QC Each batch tested by HPLC and Mass Spectrometry
🎯 Customization Custom dosage, vial cap color, peptide blends available for bulk orders
🌍 Global Shipping FedEx/DHL/special line available, free shipping on orders over $1000
Primary Research Applications
-
GLP-1 receptor agonist mechanism studies
-
Metabolic research and glucose regulation studies
-
Peptide-based drug development and efficacy evaluation
-
Cell signaling pathway research
Packaging Structure (From Outer to Inner)
Level Description
Outer Packaging Standard cardboard box
Middle Packaging Product box (branded/plain) containing a plastic box inside
Inner Packaging Plastic box holding 10 glass vials with foam or partition protection
Vial Clear glass vial, aluminum-plastic flip-off seal, labeled with product name, dosage, and batch number
Each Plastic Box Contains:
10 vials of peptide (2mg / 5mg / 10mg / 15mg / 20mg / 30mg per vial, based on your order)
Each vial is individually sealed with label
Foam or plastic partition to prevent vials from bumping into each other
Shipping Methods & Delivery Time
Shipping Method Cost Delivery Time
Special Line / Express $40 (under 5kg) ~14 days
UK Special Line Same as above ~25 days (slightly delayed)
UPS / FedEx $70 7-10 days
Shipping Policies
Policy Details
Free Shipping On orders over $1000
Remote Area Fee Some remote areas may incur an extra $35 (as determined by FedEx/UPS)
Lead Time 3-5 business days after payment confirmation
Frequently Asked Questions (FAQ)
Q1: Can I get a sample before placing an order?
Yes, samples are available upon request. Samples are not provided for free. You will need to pay for both the sample cost and the shipping fee. The sample fee will be deducted from your bulk order payment once you proceed with a formal order.
Q2: What payment methods do you accept?
We accept wire transfer (T/T), PayPal, and bank transfer. You may choose the most convenient method for you.
Q3: How and when can I receive my order after payment?
-
Small quantity orders: Shipped via international express (DHL, FedEx, UPS, etc.). Delivery time: 7-10 days after shipment.
-
Large quantity orders: Shipped by sea. Delivery time: 15-30 days depending on the destination port.
-
Special line: ~14 days delivery time (under 5kg, $40).
Q4: Can I use my own label or packaging?
Yes, OEM service is available for bulk orders. We can customize labels, vial dosage, vial cap color, and packaging according to your requirements. Please contact us for details.
Q5: What is your MOQ (Minimum Order Quantity)?
-
Retail MOQ: 1 kit/dosage/item
-
Customized packaging (e.g., custom vial size, cap color): 20-50 kits/dosage/item
Q6: Do you provide a Certificate of Analysis (COA) with each order?
Yes, each batch comes with a COA (HPLC purity test report). Third-party testing is also available upon request.
Q7: How should I store the peptide?
Store at -20°C, protected from light, and keep sealed. Once reconstituted, refrigerate at 2-8°C and use within the recommended timeframe.
Q8: What documents will be included with my shipment?
Commercial invoice, packing list, COA, and MSDS will be included with each shipment.
Research & Reference Note
99% Purity IGF-1 LR3 Synthetic Peptide for Laboratory Research Application is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals