Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 Fast delivery High purity Weight loss peptide Safe transportation
LL37 Fast delivery  High purity  Weight loss peptide Safe transportation buy - large image1
LL37 Fast delivery  High purity  Weight loss peptide Safe transportation buy - image1
LL37 Fast delivery  High purity  Weight loss peptide Safe transportation buy - image2
LL37 Fast delivery  High purity  Weight loss peptide Safe transportation buy - image3
LL37 Fast delivery  High purity  Weight loss peptide Safe transportation buy - image4
LL37 Fast delivery  High purity  Weight loss peptide Safe transportation buy - image5
LL37 Fast delivery  High purity  Weight loss peptide Safe transportation buy - image6

LL37 Fast delivery High purity Weight loss peptide Safe transportation

TDS 1 Inquiries

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangzhou

Brand:

SIHAI

Packaging:

5 mg/vial

Price valid (until):

2027-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    N

    CAS 154947-66-7
    Name LL37
    Package   Foil Bag , Abe bottle or other
    Transportation   By Air or or other means
    Sample Availiable


    Shop Semaglutide Exclusive offer Factory direct High purity Weight loss peptide-Detailed Image 1 Shop Adipotide Superior quality Meet the research requirements Freeze dried powder-Detailed Image 2 Shop SM05 Semaglutide CAS910463-68-2 After Sales Assure High Efficiency Top rated-Detailed Image 3



    Contact Information:WhatsApp(+86)13152736103 Email address:saIes02@adsh.top

    1.:We offer various types of peptides,about the peptides,we can provide the good quality,the good price.
    Customers who have ordered our products(peptides)have had very good feedback.
    World wide relaible buyers can contact us about the peptides.

    2:Company advantages

    We are engaged in the development, marketing and sales of intermediates, Peptides, Ste roids, Sterol, chemicals and other products.
    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa.
    In order to serve customers well, the company has established special technical department and after-sale service department.
    We will make careful reply if you get any question. The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence,
    seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Are you from these countries?United States, Canada, Spain, Portugal, Australia, Brazil, France, Netherlands, United Kingdom, Bulgaria, Norway, and more.
    Good News! We guarantee smooth customs clearance in key destinations, including Germany and Finland, with no issues at all. Your packages will be securely delivered within 5-15 days.

    Why Choose Us:
    Fast Delivery: We ship your order quickly using DHL, FedEx, and other options. Most orders arrive in 5-15 days.
    Customs Clearance: No customs problems! We make sure your order is delivered smoothly.
    Easy Payment: Pay with Bitcoin,USDT,PAYAPL, or bank transfer.
    Good Quality: Our products are great, and we support small test orders.

    3:Company Introduction
    Shanxi An Da Si Hai Technology Co., Ltd. is a professional manufacturer of various peptide products and chemical raw materials.
    We have a dedicated R&D team and a reliable, efficient logistics team to ensure you receive high-quality products safely and promptly. Our customers come from countries including the United States, Europe,
    Europe, Japan, South Korea, and India. Most of our main products are in stock and ready for immediate shipment. Please let us know the specific quantity you need, and we will offer you the most competitive price. Feel free to contact us for more information.

    4:FAQ

    Q1:Are you a supplier or a manufacturer?
    A:We are both a supplier and a manufacturer.

    Q2:How will you deliver the goods?
    A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Q3:Which kind of payment terms do you accept?
    A:, Bitcoin, PayPal.USDT.You can choose the one which is convenient for you.

    Q4:How is the after-sales service?
    A:We will provide high-quality products and ensure 100% safe deliver.

    Q5:how can we guarantee quality?
    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.


    Q6:Is there any discount?
    A:Yes, for larger quantity, we always support with better price.


    Please note the following points when storing peptides:
    - Store peptides in a cool, dry and dark environment
    - Avoid repeated freezing and thawing of peptides
    - Prevent peptides from being overexposed to air
    - Protect peptides from light
    - Do not store peptides in solution for a long time
    - Aliquot peptides according to specific experimental requirements

    Shop TR10 Tirzepatide  CAS 2023788-19-2High purity Best seller Safety Certified-Detailed Image 4 Shop Epitalon cas307297-39-8 High purity Freeze dried powder Health Care-Detailed Image 5 Shop Melanotan II Safe transportation Best seller  Repairing for skin-Detailed Image 6 Shop DSIP  Safe Ingredient Multi Functions Freeze dried powder-Detailed Image 7 Shop Melanotan II ML10 Best-selling around the world Cosmetic Raw Materials Safety Certified-Detailed Image 8 Shop Hot sale Premium quality High purity Fast delivery Semaglutide-Detailed Image 10 Shop DSIP  Customizable Options Quality Guarantee After Sales Assured-Detailed Image 10

    Certificates
    • LL37 Fast delivery  High purity  Weight loss peptide Safe transportation Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Shanxi An Da Si Hai Technology Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.