Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality buy - large image1

Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality buy - image1

Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality buy - image2

Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality buy - image3

Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality buy - image4

Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality

COA TDS 10 Inquiries

Unit Price: Get Latest Price 

CAS No.:

52232-67-4

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONGKONG

Brand:

STTY

Packaging:

10via/kit

Price valid (until):

2026-07-03

Contact Supplier

 Chat Now

Jingdezhen Shengtian Tuyuan Trading Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Peptide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

+852 5384 5049 Justin

Product Detail

Here is an English product overvied for Teriparatid :

Composition:

Teriparatide is a recombinant, synthetically produced 34‑amino‑acid polypeptide corresponding to the biologically active N‑terminal fragment of human parathyroid hormone (hPTH 1‑34), with the sequence Ser‑Val‑Ser‑Glu‑Ile‑Gln‑Leu‑Met‑His‑Asn‑Leu‑Gly‑Lys‑His‑Leu‑Asn‑Ser‑Met‑Glu‑Arg‑Val‑Glu‑Trp‑Leu‑Arg‑Lys‑Lys‑Leu‑Gln‑Asp‑Val‑His‑Asn‑Phe (C₁₈₁H₂₉₁N₅₅O₅₁S₂, MW ≈ 4117.7 Da), expressed via recombinant DNA technology in Escherichia coli and supplied as a highly purified lyophilized powder for laboratory research.

Mechanism of Action:

It functions as a selective agonist at the parathyroid hormone type 1 receptor (PTH1R), a class‑B G protein–coupled receptor abundantly expressed on osteoblasts, osteocytes, and renal cells. Binding activates Gs‑cAMP‑PKA and Gq‑PLC‑PKC signaling cascades as well as β‑arrestin–mediated pathways; intermittent exposure preferentially stimulates osteoblast differentiation from mesenchymal stem cells, prolongs osteoblast survival by suppressing apoptosis, activates quiescent bone‑lining cells, and upregulates Wnt/β‑catenin signaling via sclerostin inhibition—thereby promoting net bone formation while briefly increasing renal calcium reabsorption and phosphate excretion.

Research Advantages:

Unlike antiresorptive agents, Teriparatide exhibits a well‑characterized anabolic window in which pulsatile receptor activation yields dose‑dependent increases in trabecular and cortical bone volume, callus formation in fracture models, and upregulation of bone‑formation biomarkers (e.g., osteocalcin, bone‑specific alkaline phosphatase) without immediate parallel rise in resorption markers. Its defined peptide structure, reproducible pharmacokinetics in animal models, and the clear differential between intermittent (anabolic) versus continuous (catabolic) PTH signaling make it a valuable reference compound for studying osteoblast biology, bone‑remodeling coupling, and skeletal regenerative pharmacology.

Intended Research Population:

This compound is intended for non‑clinical, in vitro, and in vivo investigations involving osteoporosis models (post‑menopausal, androgen‑deficient, or glucocorticoid‑induced), age‑related bone loss, fracture‑healing and distraction‑osteogenesis models, scaffold‑based bone‑tissue‑engineering studies evaluating osteoinductive adjuvants, and basic research on PTH1R signal transduction and Wnt pathway crosstalk; it is an investigational reagent restricted to scientific laboratory use and is not approved for therapeutic, diagnostic, or human administration outside controlled experimental protocols.

Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 1

Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 2

Basic Info

Items	Specifications
Product Name	Teriparatide
CAS number	52232-67-4
Purity	99%
Appearance	White or almost white powder
Storage	Dry and Cool Place
Grade Standard	Top Quality
Grade	Pharmaceutical Grade
Specification	5mg 10mg 20mg

Our Company

Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

When storing peptides, remember to:
• Store peptide in a cold, dry, dark place
• Avoid repeated freezing and thawing of peptide
• Avoid overexposure to the air
• Avoid light exposure
• Avoid storing peptides in solution long term
• Aliquot peptide according to experimental requirements

Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 7

Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin Hot-selling-Detailed Image 2 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 12

Why choose us

Our Advantages：

1.High quality with competitive price.

2. All purity>99%.

3. We are manufacturer and can provide high quality products with factory price.

Fast and safe delivery.

1. Parcel can be sent out in 24 hours after payment tracking number available.

2. Secure and discreet shipment verious transportation methods for your choice.

3. Customs pass rate >99%.

We have clients throughout the world.

1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.

3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 13

Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 14

FAQ

1. How to make an order?
Send me message and let me know what you need with quantity , then i will calculate to you

2. What's the lead time and shipping ways?
We will delivery to the package by UPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

3. How do i keep the peptides when i receive it ?
Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

4. What's the payment methods?
We could accept pay through Wise, Bank Transfer, Alipay,Alibaba USDT and BTC.

Certificates

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Peptide

Location:
Room 1501, Building 1, Changnan Mansion, Country Garden, on the west side of Taoyang North Road

Payment Terms:
TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

Average lead Time:
11

Year of Establishment:
2025

Inquiry History

10 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Teriparatide Acetate CAS NO.52232-67-4 ,99294-94-7	Research grade/		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Teriparatide Pharmacy Grade	Pharmaceutical Grade/		zpcChina	Inquiry
52232-67-4	/		Guangzhou Yaoguang Technology Co., Ltd.	Inquiry
Teriparatide cas52232-67-4 high purity 99% peptide for osteoporosis	Pharmaceutical Grade/99	$1/G FOB		Inquiry

Teriparatide | China Factory | Cosmetic Peptides | 99% Purity | Lyophilized Powder | hign quality

Product Description

Seller Information