Contact us Whatsapp:
+852 5384 5049 Justin
Here is an English product overvied for LL37 :
Composition:
LL-37 is a synthetic cationic antimicrobial peptide corresponding to the C-terminal 37‑amino‑acid cleavage product of human cathelicidin hCAP18, with the sequence [LL-37, 37 aa] (molecular formula C₁₉₈H₃₆₈N₆₆O₅₃, MW ≈ 4493 Da); it is produced by solid‑phase peptide synthesis or recombinant expression systems and supplied as a high‑purity lyophilized powder for laboratory research.
Mechanism of Action:
It exerts broad-spectrum antimicrobial activity primarily through electrostatic interaction with negatively charged microbial membranes—particularly those of Gram‑negative and Gram‑positive bacteria, certain fungi, and enveloped viruses—followed by peptide insertion, pore formation (via carpet or toroidal-pore models), and membrane depolarization leading to cytoplasmic leakage. In addition to direct microbicidal effects, LL-37 functions as a host-defense immunomodulator by binding to and signaling through formyl peptide receptor‑like 1 (FPRL1/ALX) and P2X₇ receptors on neutrophils, monocytes, and epithelial cells, thereby promoting chemotaxis, cytokine secretion (e.g., IL‑1β, TNF‑α), wound‑healing–associated angiogenesis, and resolution of inflammation.
Research Advantages:
Unlike conventional antibiotics, LL-37 acts on conserved membrane lipid components rather than specific microbial enzymes or ribosomes, making it a valuable model for studying mechanisms of antibiotic resistance avoidance and innate immune activation. Its dual role—simultaneous antimicrobial action and immunomodulatory signaling—allows researchers to investigate multicellular innate responses, epithelial barrier function, and peptide‑mediated modulation of TLR signaling and autophagy in a single system; it also demonstrates measurable activity in serum‑containing media at micromolar concentrations and is amenable to site‑directed analog design for structure–activity relationship studies.
Intended Research Population:
This compound is designated for in vitro and non‑clinical ex vivo studies involving antimicrobial peptide mechanisms, host‑defense immunology, epithelial barrier models (skin, airway, gut), wound‑healing assays, sepsis‑related cytokine storm models, and autoimmune conditions such as psoriasis where cathelicidin dysregulation is implicated; it remains an investigational reagent restricted to scientific laboratory use and is not approved for therapeutic, diagnostic, or human/animal administration outside controlled experimental protocols.
Basic Info
| Items | Specifications |
| Product Name | LL37 |
| CAS number | 154947-66-7 |
| Purity | 99% |
| Appearance | White or almost white powder |
| Storage | Dry and Cool Place |
Grade Standard | Top Quality |
| Grade | Pharmaceutical Grade |
| Specification | 5mg 10mg 20mg |
Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.
When storing peptides, remember to:
• Store peptide in a cold, dry, dark place
• Avoid repeated freezing and thawing of peptide
• Avoid overexposure to the air
• Avoid light exposure
• Avoid storing peptides in solution long term
• Aliquot peptide according to experimental requirements
Our Advantages：
1.High quality with competitive price.
2. All purity>99%.
3. We are manufacturer and can provide high quality products with factory price.
Fast and safe delivery.
1. Parcel can be sent out in 24 hours after payment tracking number available.
2. Secure and discreet shipment verious transportation methods for your choice.
3. Customs pass rate >99%.
We have clients throughout the world.
1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.
2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.
3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.
1. How to make an order?
Send me message and let me know what you need with quantity , then i will calculate to you
2. What's the lead time and shipping ways?
We will delivery to the package by UPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.
3. How do i keep the peptides when i receive it ?
Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.
4. What's the payment methods?
We could accept pay through Wise, Bank Transfer, Alipay,Alibaba USDT and BTC.
Indonesia
