Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 | Peptides for Advanced Research| 99% Purity | Lyophilized Powder | hign quality
LL37 |  Peptides for Advanced Research| 99% Purity  | Lyophilized Powder | hign quality buy - large image1
LL37 |  Peptides for Advanced Research| 99% Purity  | Lyophilized Powder | hign quality buy - image1
LL37 |  Peptides for Advanced Research| 99% Purity  | Lyophilized Powder | hign quality buy - image2
LL37 |  Peptides for Advanced Research| 99% Purity  | Lyophilized Powder | hign quality buy - image3
LL37 |  Peptides for Advanced Research| 99% Purity  | Lyophilized Powder | hign quality buy - image4
LL37 |  Peptides for Advanced Research| 99% Purity  | Lyophilized Powder | hign quality buy - image5
LL37 |  Peptides for Advanced Research| 99% Purity  | Lyophilized Powder | hign quality buy - image6

LL37 | Peptides for Advanced Research| 99% Purity | Lyophilized Powder | hign quality

COA TDS 1 Inquiries

Unit Price:

$145-154/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONGKONG

Brand:

STTY

Packaging:

10via/kit

Price valid (until):

2026-07-04

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Contact us   Whatsapp: 

    +852 5384 5049   Justin



       Product Detail   


    Here is an English product overvied for  LL37  :

    Composition:
    LL-37 is a synthetic cationic antimicrobial peptide corresponding to the C-terminal 37‑amino‑acid cleavage product of human cathelicidin hCAP18, with the sequence [LL-37, 37 aa] (molecular formula C₁₉₈H₃₆₈N₆₆O₅₃, MW ≈ 4493 Da); it is produced by solid‑phase peptide synthesis or recombinant expression systems and supplied as a high‑purity lyophilized powder for laboratory research.

    Mechanism of Action:
    It exerts broad-spectrum antimicrobial activity primarily through electrostatic interaction with negatively charged microbial membranes—particularly those of Gram‑negative and Gram‑positive bacteria, certain fungi, and enveloped viruses—followed by peptide insertion, pore formation (via carpet or toroidal-pore models), and membrane depolarization leading to cytoplasmic leakage. In addition to direct microbicidal effects, LL-37 functions as a host-defense immunomodulator by binding to and signaling through formyl peptide receptor‑like 1 (FPRL1/ALX) and P2X₇ receptors on neutrophils, monocytes, and epithelial cells, thereby promoting chemotaxis, cytokine secretion (e.g., IL‑1β, TNF‑α), wound‑healing–associated angiogenesis, and resolution of inflammation.

    Research Advantages:
    Unlike conventional antibiotics, LL-37 acts on conserved membrane lipid components rather than specific microbial enzymes or ribosomes, making it a valuable model for studying mechanisms of antibiotic resistance avoidance and innate immune activation. Its dual role—simultaneous antimicrobial action and immunomodulatory signaling—allows researchers to investigate multicellular innate responses, epithelial barrier function, and peptide‑mediated modulation of TLR signaling and autophagy in a single system; it also demonstrates measurable activity in serum‑containing media at micromolar concentrations and is amenable to site‑directed analog design for structure–activity relationship studies.

    Intended Research Population:
    This compound is designated for in vitro and non‑clinical ex vivo studies involving antimicrobial peptide mechanisms, host‑defense immunology, epithelial barrier models (skin, airway, gut), wound‑healing assays, sepsis‑related cytokine storm models, and autoimmune conditions such as psoriasis where cathelicidin dysregulation is implicated; it remains an investigational reagent restricted to scientific laboratory use and is not approved for therapeutic, diagnostic, or human/animal administration outside controlled experimental protocols.

    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 1



    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 2 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 3 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 4 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 5 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 6




    Basic Info



       Items Specifications
    Product  Name
    LL37
    CAS number 154947-66-7
    Purity 99%
    Appearance White or almost white powder
    Storage Dry and Cool Place

    Grade Standard

    Top Quality

    Grade Pharmaceutical Grade
    Specification 5mg 10mg 20mg


      Our Company  


    Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements


    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 7

    Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 2 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 3 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 4 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 5 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 12


      Why choose us  


    Our Advantages:

    1.High quality with competitive price.

    2. All purity>99%.

    3. We are manufacturer and can provide high quality products with factory price.

    Fast and safe delivery.

    1. Parcel can be sent out in 24 hours after payment tracking number available.

    2. Secure and discreet shipment verious transportation methods for your choice.

    3. Customs pass rate >99%.

    We have clients throughout the world.

    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.

    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 13

    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 14


      FAQ   


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by UPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods?
    We could accept pay through Wise, Bank Transfer, Alipay,Alibaba USDT and BTC.


    Certificates
    • LL37 |  Peptides for Advanced Research| 99% Purity  | Lyophilized Powder | hign quality Certificates 2

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    Room 1501, Building 1, Changnan Mansion, Country Garden, on the west side of Taoyang North Road

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    11

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.