 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Teriparatide acetate for Sale > -Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.

-Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados. buy - large image1

-Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image1

-Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image2

-Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image3

-Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados. buy - image4

-Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.

Name: -Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.
Brand: Boruimei-02
SKU: pr2606043160
Price: 8 USD
Availability: InStock

10 Inquiries

Unit Price: Get Latest Price 

CAS No.:

52232-67-4

Grade:

Cosmetics Grade

Content:

99%

Port:

SHENZHEN/HONGKONG

Brand:

Boruimei-02

Packaging:

10 vials/box

Price valid (until):

2026-07-04

Contact Supplier

 Chat Now

Boruimei

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Polypeptide Products

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Company Profile

Jinan Boruimei Trading Co., Ltd. Professional Peptide Manufacturer, Facilitating Innovation in Life Sciences As a high-tech enterprise deeply involved in the field of peptides, Libilitai Biotechnology Company focuses on the research, production, and customized services of high-quality peptides. With its outstanding technical strength and strict quality control system, the company provides reliable peptide products and solutions to global research institutions, pharmaceutical companies, and biotechnology companies.Strong capabilities, establishing the foundation of quality.

Shop -Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.-Detailed Image 1

Product Detail

Product Name	-Teriparatide
Parametric	10mg
Purity	≥99%
Certificate	COA
Payment	PayPal/TT/CC/BTC/USDT/Alipay
Delivery Time	7-8 days（air express）

Payment

•Peptide Form: Freeze-dried powder

• Peptide Packaging: 10 bottles per box

• Peptide Purity: 99%

• Minimum Order Quantity: 1 box (10 vials)

Shop -Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.-Detailed Image 2

Shop -Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.-Detailed Image 3

FAQ

1.Q:What is your production cycle and delivery schedule?

A:For regular products, the delivery cycle is usually 3 to 7 days. We also have buffer stocks of key materials to ensure a stable and continuous supply.

2. Q: What are your main export markets?

A:Our products are sold all over the world, including the United States, Canada, Australia, the Netherlands, New Zealand, Italy, France, Germany, Mexico and many other countries and regions.

3. Q: How do you handle the after-sales service and quality issues?

A:In case of any issues related to quality, transportation or documentation, our team will promptly communicate and provide effective solutions to safeguard the interests of our customers.

4. Q: How is the quality of the product?

A: Before each batch of our products is put on the market for sale, they will undergo corresponding quality inspections to ensure that the purity is above 99% and there will be corresponding test reports for reference.

5. Q: How to make the payment？

A: Bitcoin, USDT, PayPal

Why choose us

1.High Purity Our peptide products undergo advanced purification processes, achieving extremely high purity with minimal impurity content. This ensures the stability and effectiveness of the products, making them a reliable choice for various applications, such as scientific research, beauty skincare, and healthcare. Whether for academic research or commercial use, our products offer a quality guarantee.

2.Strong Activity Through our unique production process, we maximize the retention of biological activity in peptides, allowing them to be quickly absorbed and utilized by the human body to exert their full effects. For example, in beauty skincare, active peptides promote collagen production and improve skin elasticity. In healthcare, peptides enhance immunity and regulate body functions.

3.Customization Service We have a professional R&D team that can customize and synthesize various peptides with specific sequences and functions based on your needs. Whether it's for drug research and development, biological detection, or other specialized fields, we can meet your personalized requirements.

4.Price We combine industry and trade, and with 12 years of experience, we are able to provide competitive prices and high-quality products.

5.Packaging & Transportation We can package according to customer requirements and customize products. For transportation, we handle door-to-door delivery, eliminating the need for you to manage any customs clearance.

Shop -Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.-Detailed Image 4

Shipping/Payment

Shop -Teriparatide / A pureza atinge mais de 99%, e todos os produtos foram testados.-Detailed Image 5

Basic Info

Product Name:

Teriparatide acetate

Other Name:

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE

CAS No.:

52232-67-4

Molecular Formula:

C172H278N52O47S2

InChIKeys:

BUUKFBVDKSFMHN-LKMAISLMSA-N

Molecular Weight:

3890.49792

EC Number:

640-978-1

Color/Form:

White to Off-White

HScode:

2937190000

Categories:

Bulk Drug Intermediates

Characteristics

Melting Point:

>205oC (dec.)

Water Solubility:

Soluble to 0.40 mg/ml in water

Critical Temperature & Pressure:

−20°C

See More Teriparatide acetate Properties 

Hazard Identification

Classification of the substance or mixture

Carcinogenicity, Category 2

Reproductive toxicity, Category 2

GHS label elements, including precautionary statements

Precautionary statement(s)
Pictogram(s)
Signal word	Warning
Hazard statement(s)	H351 Suspected of causing cancer H361 Suspected of damaging fertility or the unborn child
Prevention	P203 Obtain, read and follow all safety instructions before use. P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...
Response	P318 IF exposed or concerned, get medical advice.
Storage	P405 Store locked up.
Disposal	P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

Other hazards which do not result in classification

no data available

Handling and Storage

Precautions for safe handling

Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

Conditions for safe storage, including any incompatibilities

Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

See More Teriparatide acetate Safety Data Sheet 

Seller Information

Business Type:
Trader

Main Products:
Polypeptide Products

Location:
No. 917, 9th Floor, Unit 1, Building 19, Shengshi Huayuan Business Center, Shunhua Road Sub-district, High-tech Zone, Jinan City, Shandong Province

Total Annual Revenue:
Less than $1 million

Total Employees:
5-10

Year of Establishment:
2026

Inquiry History

10 Inquiries

Country	Product	Purchase Quantity	Date Posted
United States	Teriparatide	1 KG	May 28, 2026
Russia	teriparatide	100 MG	Feb 23, 2026
Kazakstan	Teriparatide	1 KG	Jan 4, 2026
Kazakstan	Teriparatide	5 MG	Jan 1, 2026
Kazakstan	teriparatide	1 KG	Nov 17, 2025
United States	Teriparatide	10 MT	May 29, 2026
Bulgaria	teripatatide	1	May 17, 2026
Kazakstan	Teriparatide	5 MG	Jan 2, 2026
United Kingdom	Supply	1	Mar 5, 2024
Germany	Teriparatide Acetate	5 MG	Jul 5, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Teriparatide Acetate CAS NO.52232-67-4 ,99294-94-7	Research grade/		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
Teriparatide 52232-67-4	Reagent Grade/95	$800-900/G FOB	cellmano peptide	Inquiry
Teriparatide Pharmacy Grade	Pharmaceutical Grade/		zpcChina	Inquiry
52232-67-4	/		Guangzhou Yaoguang Technology Co., Ltd.	Inquiry
Teriparatide cas52232-67-4 high purity 99% peptide for osteoporosis	Pharmaceutical Grade/99	$1/G FOB		Inquiry