Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > 375 LL37 5mg 10mg /vial | 99% Purity | Lyophilized Powder | Fast Shipping | Competitive Prices
375  LL37   5mg  10mg /vial  | 99% Purity |  Lyophilized Powder | Fast Shipping | Competitive Prices buy - large image1
375  LL37   5mg  10mg /vial  | 99% Purity |  Lyophilized Powder | Fast Shipping | Competitive Prices buy - image1
375  LL37   5mg  10mg /vial  | 99% Purity |  Lyophilized Powder | Fast Shipping | Competitive Prices buy - image2
375  LL37   5mg  10mg /vial  | 99% Purity |  Lyophilized Powder | Fast Shipping | Competitive Prices buy - image3
375  LL37   5mg  10mg /vial  | 99% Purity |  Lyophilized Powder | Fast Shipping | Competitive Prices buy - image4
375  LL37   5mg  10mg /vial  | 99% Purity |  Lyophilized Powder | Fast Shipping | Competitive Prices buy - image5
375  LL37   5mg  10mg /vial  | 99% Purity |  Lyophilized Powder | Fast Shipping | Competitive Prices buy - image6

375 LL37 5mg 10mg /vial | 99% Purity | Lyophilized Powder | Fast Shipping | Competitive Prices

3 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

High Purity Grade

Content:

99%

Port:

china

Brand:

Factory

Packaging:

5mg 10 mg /vial

Price valid (until):

2026-07-08

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides,Retatrutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    sales Manager:Molly WhatsApp:+85256107883 Mail: mollyy787@gmail.com   

    sales Manager:Molly WhatsApp:+85256107883 Mail: mollyy787@gmail.com

    sales Manager:Molly WhatsApp:+85256107883 Mail: mollyy787@gmail.com

    We specialize in supplying high-quality peptides directly from manufacturers, offering a wide variety of peptides to meet diverse research needs. We provide reliable products, highly competitive prices, and consistent inventory support to customers worldwide. With advanced production systems and rigorous quality control processes, all products are manufactured under strict standards with a purity of up to 99%, ensuring consistency and reliability for research applications.


    We maintain a stable inventory system, with most products in stock and ready for immediate shipment. This enables us to process orders quickly and deliver efficiently worldwide. No matter where our customers are located, we are committed to providing safe, reliable, and timely shipping services. Every order is professionally packaged to ensure product safety during transit.


    To meet the diverse needs of our global customers, we support multiple flexible payment methods and provide professional, efficient customer service. From product inquiries and order processing to after-sales support, we prioritize efficient communication and rapid response to ensure a seamless collaborative experience.


    With years of industry experience, we have established long-term partnerships with clients across numerous countries and regions. We consistently prioritize product quality and regard customer satisfaction as our core mission. By continuously optimizing our supply chain and service systems, we are dedicated to providing our partners with more professional and reliable support.


    Whether you require a small quantity of products for R&D testing or a large-volume order to establish a long-term partnership, we are committed to providing stable supply, competitive pricing, a wide range of peptide products, trustworthy quality, and reliable service. Looking ahead, we will continue to uphold the principles of “Quality First, Integrity in Cooperation, and Long-Term Mutual Benefit” to grow together with our global customers.




    Shop bac water   WA3  WA10   AAwater   AA3ml  AA10ml-Detailed Image 1
    Shop bac water   WA3  WA10   AAwater   AA3ml  AA10ml-Detailed Image 2
    Shop bac water   WA3  WA10   AAwater   AA3ml  AA10ml-Detailed Image 3
    Shop bac water   WA3  WA10   AAwater   AA3ml  AA10ml-Detailed Image 4
    Shop bac water   WA3  WA10   AAwater   AA3ml  AA10ml-Detailed Image 5
    Shop bac water   WA3  WA10   AAwater   AA3ml  AA10ml-Detailed Image 6
    Shop bac water   WA3  WA10   AAwater   AA3ml  AA10ml-Detailed Image 7
    Shop bac water   WA3  WA10   AAwater   AA3ml  AA10ml-Detailed Image 8
    We specialize in supplying high-quality peptides directly from the manufacturer, offering a wide variety of peptides to meet different research needs. We provide customers worldwide with reliable products, competitive pricing, and stable inventory support. With advanced production systems and strict quality control procedures, all products are manufactured under high-standard conditions, with purity levels reaching up to 99%, ensuring consistency and reliability for research purposes.

    We maintain a stable inventory system, and most products are available in stock for immediate shipment. This allows us to provide fast order processing and efficient worldwide delivery. No matter where our customers are located, we are committed to offering safe, secure, and timely shipping services. Every order is professionally packaged to ensure product safety during transportation.

    To meet the diverse needs of customers worldwide, we support multiple flexible payment methods and provide professional, responsive customer service. From product inquiries and order processing to after-sales support, we focus on efficient communication and quick response to ensure a smooth cooperation experience.

    With years of industry experience, we have established long-term partnerships with customers from many countries and regions. We always regard product quality as our top priority and customer satisfaction as our core mission. By continuously optimizing our supply chain and service system, we strive to provide more professional and dependable support to our partners.

    Whether you require small quantities for research and testing or large-volume orders for long-term cooperation, we are committed to providing stable supply, reasonable pricing, a wide variety of peptides, trusted quality, and reliable service. Moving forward, we will continue to uphold the principles of “Quality First, Honest Cooperation, and Long-Term Win-Win Partnership” to grow together with customers worldwide.


    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    375 LL37 5mg 10mg /vial | 99% Purity | Lyophilized Powder | Fast Shipping | Competitive Prices is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides,Retatrutide,GHK-CU

    Location:

    Room 503, 5th Floor, Office Unit 501, New Triumphal Arch Health Products Mall, Changzheng Road, Chengguan Town, Taihe County, Fuyang City, Anhui Province

    Payment Terms:

    TT against copy of documents,D/P,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.