Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable buy - large image1
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable buy - image1
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable buy - image2
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable buy - image3
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable buy - image4
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable buy - image5
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable buy - image6

Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable

TDS 3 Inquiries

Unit Price:

$1.2-1.3/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

hk

Brand:

Customization Available

Packaging:

10vials 10vials/box

Price valid (until):

2027-11-06

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

      Product

    contact information:

    Name: Kimi

    Email address : haitai19870620@outlook.com

    Whatsapp : +85244681823


    Product Name : Tirzepatide
    CAS NO :  154947-66-7
    Appearance : white powder
    Content : 99%

    Shop China Pe ptide Factory China Fast Delivery In Stock TR G AE XA G CN CP RT MS Different Peptides-Detailed Image 1 Shop China Pe ptide Factory China Fast Delivery In Stock TR G AE XA G CN CP RT MS Different Peptides-Detailed Image 2 Shop China Pe ptide Factory China Fast Delivery In Stock TR G AE XA G CN CP RT MS Different Peptides-Detailed Image 3 Shop China Pe ptide Factory China Fast Delivery In Stock TR G AE XA G CN CP RT MS Different Peptides-Detailed Image 4 Shop China Pe ptide Factory China Fast Delivery In Stock TR G AE XA G CN CP RT MS Different Peptides-Detailed Image 5 Shop China Pe ptide Factory China Fast Delivery In Stock TR G AE XA G CN CP RT MS Different Peptides-Detailed Image 6 Shop China Pe ptide Factory China Fast Delivery In Stock TR G AE XA G CN CP RT MS Different Peptides-Detailed Image 7 Shop China Pe ptide Factory Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality-Detailed Image 8 Shop China Pe ptide Factory Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality-Detailed Image 9 Shop China Pe ptide Factory Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality-Detailed Image 10 Shop China Pe ptide Factory Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality-Detailed Image 11 Shop China Pe ptide Factory Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality-Detailed Image 12 Shop China Pe ptide Factory Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality-Detailed Image 13 Shop China Pe ptide Factory Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality-Detailed Image 14 Shop American warehouse Factory direct supply of high-quality weight loss peptide Tirzepatide-Detailed Image 4 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 5 Shop American warehouse Factory direct supply of high-quality weight loss peptide Tirzepatide-Detailed Image 6 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 7 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 8


     

      Why choose us  

    1.  Well-equipped, stable and high-quality raw material supply chain, to provide customers with the best quality products.
    2.  Strict quality inspection process and professional certificate testing to ensure the quality level of the final product.

    3.  Excellent sales team can provide customers with integrated and professional services.

    4.  Accept various OEM & ODM services to meet the different needs of different customers,low MOQ.

    5.  Professional supplier and manufacturer, an integrated enterprise integrating production and sales, providing customers with one-stop service.

    FAQ 

    1.  Do you accept customization?

    RE: We can provide corresponding customized solutions according to the specific needs of customers.

    2.   Can you provide samples?

    RE: We can provide samples to customers and send them to consumers in time by express.

    3.  How is your production capacity ?and whether it can meet customer needs in a timely manner. RE:we can produce the products required by customers in time and have sufficient production capacity.

    4.  How long is your lead time?

    RE: Within 50kg, can be shipped within 5 days. More than 50 kg, the corresponding time needs to be negotiated according to the weight of the product.

    5.  What is your terms of payment ?

    RE: Payment<=1000USD, 100% in advance. Payment>=1000USD, 50% T/T in advance ,balance before shipment. irrevocable LC at sight.

    6.  Do you have OEM or ODM service of product?

    Re: Sure. If needed, we can customize products for you.

    7.  How can you guarantee the goods you offer is qualified ?

    Re: All the goods are inspected before shipment. If the goods can't come to the quality we promise, you can ask for refund.

    8.How will you deliver the goods?
    RE:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

    Company Profile

    Our company is a modern and advanced enterprise, specializing in the production and export of raw materials for drugs, drug intermediates, and plant extracts. Our products are widely used in the fields of medicine, medical health products, cosmetics, nutritional supplements, and food additives. Our factory covers an area of 95 acres. The proposed factory will comply with GMP standards. The factory environment is clean and tidy, with a reasonable layout, and includes large and medium-sized production workshops as well as shared workshops. It is equipped with advanced equipment, quality inspection and research centers. These products have reached the advanced domestic level in terms of quality and technical content. Since its establishment, the company has attached great importance to team training and technological reform. Our modern production equipment ensures the rapid and efficient production of the entire line, with high precision. All processing, extraction, packaging and transportation are completed internally, ensuring the highest quality and efficiency. We continuously develop new ingredients and innovative products, earning respect and praise from global customers. After years of continuous development, the company has accumulated rich experience in international trade and customer resources, established a stable customer base and a complete marketing service network. In addition, the company has established long-term technical cooperation relationships with experts and professors from many universities and research institutions in the province.

    Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 9 Shop China Peptide Factory Tirzepatide TR50 weight loss subi white powder fast shipping-Detailed Image 10 Shop Customizable Retatrutide Semaglutide Tirzepatide 10mg 30mg Lyophilized Powder for Weight Loss-Detailed Image 11


    Shipping & Delivery Shop Customizable Retatrutide Semaglutide Tirzepatide 10mg 30mg Lyophilized Powder for Weight Loss-Detailed Image 12


    Effect drawing displayShop Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality Quick delivery-Detailed Image 13 Shop Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality Quick delivery-Detailed Image 14 Shop Glow ,Digestive Enzymes for Hair nails beauty Supplement High Quality Quick delivery-Detailed Image 15

    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

    Location:

    Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

    Payment Terms:

    100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Company Profile

    Our company is a modern and advanced enterprise, specializing in the production and export of raw materials for drugs, drug intermediates, and plant extracts. Our products are widely used in the fields of medicine, medical health products, cosmetics, nutritional supplements, and food additives. Our factory covers an area of 95 acres. The proposed factory will comply with GMP standards. The factory environment is clean and tidy, with a reasonable layout, and includes large and medium-sized production workshops as well as shared workshops. It is equipped with advanced equipment, quality inspection and research centers. These products have reached the advanced domestic level in terms of quality and technical content. Since its establishment, the company has attached great importance to team training and technological reform. Our modern production equipment ensures the rapid and efficient production of the entire line, with high precision. All processing, extraction, packaging and transportation are completed internally, ensuring the highest quality and efficiency. We continuously develop new ingredients and innovative products, earning respect and praise from global customers. After years of continuous development, the company has accumulated rich experience in international trade and customer resources, established a stable customer base and a complete marketing service network. In addition, the company has established long-term technical cooperation relationships with experts and professors from many universities and research institutions in the province.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.