Cosmetic Anti-Aging Peptides Foxo4-D-Retro-Inverso (DRI) Peptide Fox04 Dri

What is FOXO4-D-Retro-Inverso(DRI) Custom Peptide?
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively acts on senescent cells and alleviates impacts of chemotoxicity and aging in mice.

Application
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively acts on senescent cells and alleviates impacts of chemotoxicity and aging in mice.

Xi’an Fulecare biotech has high-technique enterprises with 10 years history,dedicate to separation, purification of the natural active ingredients production and sales.

We also produce international frontier dietary supplements such as granulated powder,solid drinks,tea sachets, capsules and tablets etc.

We have high grade clean workshop,800 square meters of inspection center equipped with more than 10 sets of HPLC,GC,IR,MASS instruments,these provides a full range of quality assurance to our products

The company has a perfect quality assurance system.We implement strict quality control standards and have passed the certification for the ISO9001 Quality Management System. The Quality Management Department is equipped with many sets of high performance liquid chromatography (HPLC)instruments, ultraviolet spectrophotometers (UV), several spectropolarimeters, a gas chromatograph (GC), melting point apparatus, and other advanced testing and experimental equipment. We make a detailed division of labor for technology research, and for quality assurance and quality control, so that we can conduct effective and comprehensive quality control in the production process. This also allows us to make comprehensive detection analysis of final products, thus ensuring products quality.