NAME: LILY
WHATSAPP:+8619948099954
+852 9842 2806
EMAIL:sales02@yw-jl.cn
Welcome to concult
Manufacturer advantages
LL-37 is the only human cathelicidin-derived cationic antimicrobial peptide, consisting of 37 amino acids, widely studied in immunology, microbiology, tissue regeneration and inflammatory disease fields.
Our product is provided as sterile white lyophilized powder with HPLC purity ≥98%. Each batch is supplied with complete COA, HPLC and MS test certificates for global universities, research institutions and biotech preclinical R&D projects. - Amino Acid Sequence: [LL-37, 37 aa]
- Molecular Weight: 4493.8 Da
- Storage: Sealed, light-proof storage at -20℃, avoid repeated freeze-thaw cycles
Core Functions & Biological Effects
Broad-Spectrum Antimicrobial Activity
LL-37 destroys the membrane structure of bacteria, fungi, enveloped viruses and parasites, showing potent inhibitory effects against both gram-positive and gram-negative drug-resistant strains. It is frequently studied for developing new alternatives to traditional antibiotics against multidrug-resistant pathogens.
Immunomodulatory Function
Regulates the release of pro-inflammatory and anti-inflammatory cytokines, recruits and activates immune cells including macrophages, neutrophils and dendritic cells; balances excessive inflammatory response, relieves inflammatory storms while enhancing host innate immunity.
Promote Wound & Tissue Repair
Stimulates proliferation and migration of keratinocytes and fibroblasts, accelerates angiogenesis, speeds up the healing of acute wounds, infected ulcers, burns and diabetic refractory wounds; meanwhile inhibits excessive scar hyperplasia.
Anti-Tumor & Tumor Microenvironment Regulation
Dual effects on tumors: inhibits proliferation, migration and invasion of some malignant tumor cells; participates in regulating tumor immune microenvironment, applied in research of tumor immunotherapy and anti-metastatic drug screening.
Anti-Biofilm Effect
Prevents the formation and accelerates the clearance of bacterial biofilms, solving the treatment difficulty of persistent infection caused by biofilm on medical implants, wounds and mucosal tissues.
Mucosal Barrier Protection
Repairs damaged skin, intestinal, respiratory and oral mucosal barriers, reduces mucosal inflammatory infiltration, widely used in research on inflammatory bowel disease, recurrent respiratory infection and periodontitis.
Main Research Directions
-
Antimicrobial & Anti-Drug Resistance Research
Development of novel antimicrobial agents against multidrug-resistant bacteria, research on antibacterial dressings, implant surface modified antibacterial materials, anti-biofilm mechanism exploration. -
Inflammatory & Mucosal Disease Research
Intervention study on inflammatory bowel disease, psoriasis, periodontitis, pneumonia and other infectious inflammatory diseases; exploration of innate immune regulatory mechanisms. -
Trauma & Regenerative Medicine Research
Mechanism research on infectious chronic wound healing, burn repair, diabetic foot ulcer treatment; development of polypeptide-based biomaterials for tissue engineering. -
Tumor Immunology Research
Study on dual regulatory effects of LL-37 on different tumors, tumor metastasis inhibition, and its application as an adjuvant in tumor immunotherapy. -
Dermatology & Autoimmune Disease Research
Pathological mechanism research of atopic dermatitis, psoriasis and other immune-related skin diseases; exploration of targeted inflammatory intervention strategies.
Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information.
We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products. 1. Outstanding Product Quality
Product quality is the foundation of our business. Our peptide compounds are synthesized using the solid-phase peptide synthesis method (SPPS), purified by high-performance liquid chromatography (HPLC), and verified by mass spectrometry (MS).
Each batch of products comes with an analysis certificate (COA), which contains key data: ••• Purity (HPLC) • Molecular weight (MS) • • • Moisture content • • • Residual solvents • • Microbial limits (if applicable).
For customers with stricter regulatory requirements, we can also provide third-party testing reports, endotoxin (LAL) data, and stability study documents. 2. Customized Services and R&D Support
We provide flexible customized synthesis services and support from an experienced R&D team. Whether you need a new peptide sequence, cosmetic-grade purity, or modified molecules (such as PEGylation or acetylation), we can deliver high-quality products on time. Our services include:
•• Custom peptide synthesis (milligram to kilogram level)
••• Peptide modification and labeling
•• Small molecule synthesis
• Project-based R&D and large-scale production
We work closely with our clients to ensure technical feasibility, rapid delivery, and cost control throughout the entire development cycle. 3. Diverse product portfolio
We offer a wide range of products that are continuously expanding:
••• Peptides: GLP-1 analogues (such as sitagliptin, tazapetide, retactide, etc.), cosmetic-grade peptides (such as acetyl hexapeptide-8, Matrixyl, etc.), anti-aging peptides, and research-grade peptides.
•• Small molecule compounds: Cognitive enhancers, NAD+ precursors/promoters (such as NMN, NR, NADH) and intermediates.
• Biochemical products: Amino acid derivatives, enzyme cofactors, and custom reagents.
To meet the constantly changing market demands, we regularly introduce new products. At the same time, we also provide batch pre-order services for customers with continuous or seasonal demands.
Advantage&Packing：
We have a professional research team and large-scale manufacturing factories. We are not only a manufacturer but also a source supplier of high-quality peptide raw materials. We support small-batch orders, offer a variety of transportation options and accept multiple payment methods with a complete range of products.
Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information.
We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products. 1. Outstanding Product Quality
Product quality is the foundation of our business. Our peptide compounds are synthesized using the solid-phase peptide synthesis method (SPPS), purified by high-performance liquid chromatography (HPLC), and verified by mass spectrometry (MS).
Each batch of products comes with an analysis certificate (COA), which contains key data: ••• Purity (HPLC) • Molecular weight (MS) • • • Moisture content • • • Residual solvents • • Microbial limits (if applicable).
For customers with stricter regulatory requirements, we can also provide third-party testing reports, endotoxin (LAL) data, and stability study documents. 2. Customized Services and R&D Support
We provide flexible customized synthesis services and support from an experienced R&D team. Whether you need a new peptide sequence, cosmetic-grade purity, or modified molecules (such as PEGylation or acetylation), we can deliver high-quality products on time. Our services include:
•• Custom peptide synthesis (milligram to kilogram level)
••• Peptide modification and labeling
•• Small molecule synthesis
• Project-based R&D and large-scale production
We work closely with our clients to ensure technical feasibility, rapid delivery, and cost control throughout the entire development cycle. 3. Diverse product portfolio
We offer a wide range of products that are continuously expanding:
••• Peptides: GLP-1 analogues (such as sitagliptin, tazapetide, retactide, etc.), cosmetic-grade peptides (such as acetyl hexapeptide-8, Matrixyl, etc.), anti-aging peptides, and research-grade peptides.
•• Small molecule compounds: Cognitive enhancers, NAD+ precursors/promoters (such as NMN, NR, NADH) and intermediates.
• Biochemical products: Amino acid derivatives, enzyme cofactors, and custom reagents.
To meet the constantly changing market demands, we regularly introduce new products. At the same time, we also provide batch pre-order services for customers with continuous or seasonal demands.
Frequently Asked Questions (FAQ)
Q1: Are you a supplier or a manufacturer?
A: We are both a supplier and a manufacturer.
Q2: How do you make the delivery?
A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
Q3: What payment methods do you accept?
A: We accept Bitcoin and USDT.
Q4: How about the after-sales service?
A: We offer high-quality products and guarantee 100% safe delivery.
Q5: How do you ensure product quality?
A: We will send you the analysis report (COA) of the sample to confirm the quality.
Q6: How can we verify the quality of the products before placing an order?
A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
Q7: Are there any discount offers? A: Yes, the larger the order quantity, the more favorable the price will be.
We support payment methods including Alipay, bank cards and USDT
We offer global shipping via EMS and FedEx with full tracking and secure delivery to all regions worldwide.
| Items | Specifications |
| cas | 154947-66-7 |
| Name | LL37 |
| Synonyms | SUNTHEANINE
THEANINE,L
N5-ethyl-L-glutamine
theanine
L-TheaMine |
| MF | C205H340N60O53 |
| Purity | 99% |
| Application | Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing. |
