Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - large image1
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image1
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image2
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image3
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image4
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image5
LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price buy - image6

LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price

TDS 1 Inquiries

Unit Price:

$12-13/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

China

Brand:

Zhongshuan

Packaging:

10mg*10vials

Price valid (until):

2026-07-22

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Sales Manager: Judy
    Whatsapp: +86 15227650217
    Email: 17334330163@163.com


    Glutathione (GSH) , a tripeptide composed of glutamic acid, cysteine, and glycine, is found in nearly all living cells, with particularly high concentrations in the liver. As the body's most vital and potent endogenous antioxidant, it is often likened to a cellular' environmental guardian 'that eliminates oxidative waste (such as free radicals) generated during metabolism and maintains the cell's redox balance.
    Glutathione contains active thiol (-SH) groups, which are key functional groups that readily bind with toxins and drugs to form two forms: the reduced form (G-SH) and the oxidized form (G-S-S-G). Under physiological conditions, the reduced form predominates. It is primarily synthesized through the body's own metabolic processes rather than relying on external intake (such as food or supplements), making its levels a reflection of the cell's self-repair and detoxification capacity.
    Glutathione directly neutralizes free radicals, slows cellular aging, and regenerates vitamins C and E to extend their effectiveness . In the liver, it participates in metabolic processes by binding with drugs, alcohol, heavy metals (e.g., lead, mercury), and harmful compounds, converting them into harmless substances for excretion. It helps maintain normal immune system function by regulating cytokines and signaling pathways to support immune cell activity. Additionally, it protects mitochondria (the body's energy factories) from oxidative damage and maintains normal metabolism of carbohydrates, fats, and proteins.

    Items Specifications
    Product Name Glutathione
    CAS No. C70-18-8
      Purity  99%
      Grade  Pharmaceutical Grade
    Appearance powder
    Storage Conditions in a cool and dry place, away from direct sunlight
    Function Skin Whitening




    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.


    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.


     

      OUR FACTORY  

     


    We are an innovative enterprise specializing in the research, development, sales, and health services of small molecule bioactive peptides. Leveraging local resources and cutting-edge biotechnology, we are deeply committed to the health industry, dedicated to bringing highly active, easily absorbed, and high-quality peptide products to every household, contributing to the health of the entire population.


    We adhere to the philosophy of "Technology Empowering Health, Quality Shaping the Future," rigorously controlling every step from raw material selection to production processes to ensure that every peptide product possesses the core advantages of high purity, high activity, and high safety. Our products cover multiple categories, including weight loss and fat reduction peptides, beauty and skincare peptides, and muscle-building and body-shaping peptides, catering to diverse health needs such as weight loss and body shaping, daily anti-aging, physical recovery, and immune regulation, providing scientific and efficient nutritional solutions for different groups.


    With the mission of "Making peptide supplementation easy for everyone and enjoying a healthy life," we uphold the principles of integrity and customer first, continuously refining our products and services. We aspire to become a trustworthy peptide product brand in the health industry, working hand in hand with our partners for mutual benefit.


    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 1
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 2
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 3
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 4
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 5
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 6
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 7
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 8
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 9
    Shop LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price-Detailed Image 10


     
    Items Specifications
    Purity 99%
    Specification 10mg, 20mg
    Appearance White sterile lyophilized powder

     

     Product Advantage 

     


    Why choose us?

    1. All peptides and raws purity >99% purityMany HPLC test reports are available (anoshik).

    2. 100% Safe delivery

    3. Cheapest prices in the market, unbeatable!

    4. Oversea warehouses and stocks: USA, Canada, Europe and Australia.

    5. Payment options: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin.usdt, Remitly,Money
    gram



     

      FAQ 

     


    Q: How about the price? Can you make it cheaper?
    A: We always take the customer's benefit as the top priority. Price is negotiable under different conditions, we are assuring you to get the most competitive price.

    Q. What's the lead time and shipping ways?
    A: We will delivery to the package by USPS, FEDEX, DHL paket and other dedicated transportation to you after receive your payment, it would take around 10-15 workdays to your address.

    Q: How do i keep the peptides when i receive it ?
    A: Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    Certificates
    • LL37 peptide high purity and High Quality 99% Purity CAS 154947-66-7 with factory price Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    Room A0693, 6th Floor, Building 3, No.5 Lvtai Road, Zhongtai Subdistrict, Yuhang District, Hangzhou City, Zhejiang Province

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Hangzhou Zhongbian Technology Co., Ltd. specializes in the R&D and manufacturing of pharmaceutical-grade and healthcare-grade bioactive raw materials and their derivatives, which are widely used in pharmaceuticals, nutraceuticals and cosmetics industries and have gained global recognition for superior bioactivity and safety. Our 100,000-square-meter factory is built in strict compliance with GMP standards, boasting a clean production environment, scientific layout, and complete R&D and manufacturing facilities for deep processing of bioactive raw materials and solvent purification, laying a solid foundation for product quality. We are committed to providing global customers with high-quality products and customized professional solutions, and strive to drive product upgrading across various industries through in-depth cultivation of biotechnology.

    Global Market Reach
    The company's products, with their outstanding quality and stable performance, are exported to over, including the Middle East, South America, North America, Southeast Asia, Africa, Europe, etc., and have accumulated a good reputation in overseas markets. Relying on our professional team and global resource integration capabilities, we fully leverage our geographical and supply chain advantages, continuously optimize localized operations, and effectively help customers reduce costs and improve efficiency while ensuring high-quality products.

    Engaged in Raw Materials for 10+ Years
    We are a biotech enterprise engaged in the R&D, production, and sales of peptides and raw materials for more than 10 years.  The company has complete experimental facilities. Advanced testing instruments ensure the stability of product quality from all aspects. If you're interested in our products, don't hesitate to contact us.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.