Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > FOXO4-DRI for Sale > High quality FOXO4-DRI reagent for cell biology laboratory testing experiments
High quality FOXO4-DRI reagent for cell biology laboratory testing experiments buy - large image1
High quality FOXO4-DRI reagent for cell biology laboratory testing experiments buy - image1
High quality FOXO4-DRI reagent for cell biology laboratory testing experiments buy - image2
High quality FOXO4-DRI reagent for cell biology laboratory testing experiments buy - image3
High quality FOXO4-DRI reagent for cell biology laboratory testing experiments buy - image4
High quality FOXO4-DRI reagent for cell biology laboratory testing experiments buy - image5
High quality FOXO4-DRI reagent for cell biology laboratory testing experiments buy - image6

High quality FOXO4-DRI reagent for cell biology laboratory testing experiments

26 Inquiries

Unit Price:

$40-45/BOU FOB

Get Latest Price
CAS No.:

2460055-10-9

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONGKONG

Brand:

band

Packaging:

10 vials per box

Price valid (until):

2027-08-26

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Items Specifications
    Product Name
    FOXO4-DRI
    Purity 99.0%
    MOQ 1 box
    Storage After reconstitution store at 2°C - 8°C, well-closed containers
    Package Box
    Appearence Powder
    CAS No.
    2460055-10-9
    Delivery time Within 3 Working Days Payment
    Specification 10mg/vial

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.Appearance: Powder
    Purity: >98% (or refer to the Certificate of Analysis)
    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.
    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).
    Solubility: To be determined
    Shelf Life: >2 years if stored properly
    Drug Formulation: To be determined
    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).
    HS Tariff Code: 2934.99.9001
    Product Specification 



    Shop KPV High Purity Lyophilized Peptide Powder for Laboratory Research Use-Detailed Image 1

    Shop KPV High Purity Lyophilized Peptide Powder for Laboratory Research Use-Detailed Image 2


      Uses


    •   FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.


     Product Properties


    • High purity & low impurities
      Good stability under proper storage
      Good solubility after reconstitution
      Strict quality control for each batch
      For in vitro laboratory research only.
    Shop Thymalin Nonapeptide Lyophilized Powder for Scientific Experimental Use Only-Detailed Image 3
    Shop Thymalin Nonapeptide Lyophilized Powder for Scientific Experimental Use Only-Detailed Image 4
    Shop Thymalin Nonapeptide Lyophilized Powder for Scientific Experimental Use Only-Detailed Image 5


      Mechanism of Action   


    1.The Thymus's Role:
    The thymus is the "military academy" that trains immune cells (T-cells)
    A young thymus efficiently trains large numbers of elite "immune soldiers"
    But as we age (after 20s), this "academy" gradually shrinks and becomes less efficient
    2.How Thymalin Works:
    Supplies "Training Materials": Thymalin provides the various "training materials" the thymus needs to function properly
    Restores Academy Function: Helps the aging "military academy" regain some training capacity
    Produces New Recruits: Promotes the generation of new, combat-effective immune cells
    Enhances Veteran Ability: Also improves the function of existing immune cells
    Improves Communication: Optimizes "communication and coordination" between different parts of the immune system
    3.Simple Analogy:
    Like replacing the battery + system optimization​ for an aging phone, not just charging the old battery
    Not only increases "soldier numbers" but improves "soldier quality" and "command system efficiency"

    Shop KPV High Purity Lyophilized Peptide Powder for Laboratory Research Use-Detailed Image 6 Shop KPV High Purity Lyophilized Peptide Powder for Laboratory Research Use-Detailed Image 7


    Product Advantages  


    Key Product Advantages
    1. Ultra-High Purity & Quality Assurance: Purity ≥99.0% verified by HPLC, with complete COA, HPLC, NMR, MS and other quality inspection reports provided, ensuring product quality meets international pharmaceutical raw material standards.
    2. Stable Production Process: Mature synthesis and lyophilization process, stable product properties, not easy to degrade, convenient for storage and long-distance transportation.
    3. Factory Direct Supply: Independent production base, sufficient inventory, fast and stable delivery, supporting small-batch trial orders and large-scale bulk wholesale.
    4. Flexible Customization: Support customized packaging specifications and personalized labeling services to meet diverse procurement needs of customers.
    5. Strict Quality Control: Full monitoring from raw material screening to finished product delivery, eliminating quality risks and ensuring product safety and reliability.

    Shop KPV High Purity Lyophilized Peptide Powder for Laboratory Research Use-Detailed Image 8

    Shop KPV High Purity Lyophilized Peptide Powder for Laboratory Research Use-Detailed Image 9
    Shop KPV High Purity Lyophilized Peptide Powder for Laboratory Research Use-Detailed Image 10


      about us  


    Hong Kong Bosen Polypeptide R&D Co., Ltd. is a world-leading manufacturer and supplier of peptide products and pharmaceutical raw materials, specializing in the chemical industry.
    Our main products include peptide products and pharmaceutical raw materials. We possess strong R&D capabilities, exquisite synthesis technologies and advanced quality control methods. We actively carry out joint ventures and cooperation with major enterprises and manufacturers, and serve society and users adhering to the concept of industrial development. We always adhere to the orientation of market demand and continuously develop new high-tech chemical products and pharmaceutical intermediates.
    I am full of confidence in the quality of our products, and many overseas customers have given high praise after receiving the goods. Our products are of excellent quality, and we solemnly promise door-to-door delivery services worldwide. 4. We provide high-quality after-sales service aiming at customer satisfaction.


      FAQ     


    1. How to preserve peptides after receiving them?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder stored at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.
     2. What is your lead time and shipping method?
    Customized items are negotiable. 1-3 working day after payment arranges the shipping. Parcels shipping by sea, by air, or by express (EMS, UPS, DHL, TNT, FEDEX, etc). 
    3. Is the shipping 100% Guarantee?
    Yes, we offer 100% Shipping Guarantee. If any seized parcel we will do resending. 

    4. What payment methods do you support?
     Wise/Bank wire/BTC/USTD/alibaba/Paypal
    5. Will I have any side effects after using peptide?
    If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.

    Basic Info
    Product Name:

    FOXO4-DRI

    Other Name:

    FOXO4-DRI;FOXO4 /FOXO4-DRI;FOX04-DRI (D-Retro-Inverso);Fox4-dri

    CAS No.:

    2460055-10-9

    Molecular Weight:

    0

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

    Location:

    RM 701, UNIT 108, 7/F, TWR B NEW MANDARIN PLAZA 14 SCIENCE MUSEUM RD TSIM SHA TSUI HONG KONG

    Year of Establishment:

    2026

  • Inquiry History
    26 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    FOXO4-DRI

    1 G Dec 3, 2023
    United States

    Fox04-dri

    1 G May 20, 2026
    United States

    hot-sale-high-purity-raw-powder-fox04-dri-nad-ghk-cu-mot

    2 PCS Dec 19, 2025
    United States

    foxo4 dri

    10 MT Dec 13, 2025
    United States

    Fox04

    10 MG Oct 30, 2024
    United Kingdom

    High purity foxo4

    1 G May 31, 2026
    United Kingdom

    Foxo4-Dri

    10 MG May 5, 2026
    United States

    Fox04-dri

    100 MG Apr 28, 2026
    Cyprus

    Foxo4 dri

    10 MT Apr 4, 2026
    Cyprus

    FOXO4-DRI

    1 KG Feb 2, 2026
    United States

    FOX04-DRI

    10 PCS Jan 12, 2026
    United States

    FOX04

    10 PCS Jan 12, 2026
    United States

    Foxo4 Dri

    40 MG Sep 15, 2025
    United States

    Fox04 dri

    10 MT Jun 21, 2026
    United States

    FOX04-DRI powder

    10 MT May 29, 2026
    United States

    fox04

    1 G Apr 29, 2026
    United States

    FOXO4-DRI

    1 KG Mar 23, 2026
    United States

    Foxo4-Dri

    Nov 24, 2025
    United States

    FOXO4

    10 PCS Nov 15, 2025
    United States

    Fox04

    1 G Nov 10, 2025
    • 1
    • 2
    • Go to Page Go
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.