High quality FOXO4-DRI reagent for cell biology laboratory testing experiments

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.Appearance: Powder
Purity: >98% (or refer to the Certificate of Analysis)
Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.
Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).
Solubility: To be determined
Shelf Life: >2 years if stored properly
Drug Formulation: To be determined
Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).
HS Tariff Code: 2934.99.9001
Product Specification 

•   FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

• High purity & low impurities
  Good stability under proper storage
  Good solubility after reconstitution
  Strict quality control for each batch
  For in vitro laboratory research only.

1.The Thymus's Role:
The thymus is the "military academy" that trains immune cells (T-cells)
A young thymus efficiently trains large numbers of elite "immune soldiers"
But as we age (after 20s), this "academy" gradually shrinks and becomes less efficient
2.How Thymalin Works:
Supplies "Training Materials": Thymalin provides the various "training materials" the thymus needs to function properly
Restores Academy Function: Helps the aging "military academy" regain some training capacity
Produces New Recruits: Promotes the generation of new, combat-effective immune cells
Enhances Veteran Ability: Also improves the function of existing immune cells
Improves Communication: Optimizes "communication and coordination" between different parts of the immune system
3.Simple Analogy:
Like replacing the battery + system optimization​ for an aging phone, not just charging the old battery
Not only increases "soldier numbers" but improves "soldier quality" and "command system efficiency"

Key Product Advantages
1. Ultra-High Purity & Quality Assurance: Purity ≥99.0% verified by HPLC, with complete COA, HPLC, NMR, MS and other quality inspection reports provided, ensuring product quality meets international pharmaceutical raw material standards.
2. Stable Production Process: Mature synthesis and lyophilization process, stable product properties, not easy to degrade, convenient for storage and long-distance transportation.
3. Factory Direct Supply: Independent production base, sufficient inventory, fast and stable delivery, supporting small-batch trial orders and large-scale bulk wholesale.
4. Flexible Customization: Support customized packaging specifications and personalized labeling services to meet diverse procurement needs of customers.
5. Strict Quality Control: Full monitoring from raw material screening to finished product delivery, eliminating quality risks and ensuring product safety and reliability.

Hong Kong Bosen Polypeptide R&D Co., Ltd. is a world-leading manufacturer and supplier of peptide products and pharmaceutical raw materials, specializing in the chemical industry.
Our main products include peptide products and pharmaceutical raw materials. We possess strong R&D capabilities, exquisite synthesis technologies and advanced quality control methods. We actively carry out joint ventures and cooperation with major enterprises and manufacturers, and serve society and users adhering to the concept of industrial development. We always adhere to the orientation of market demand and continuously develop new high-tech chemical products and pharmaceutical intermediates.
I am full of confidence in the quality of our products, and many overseas customers have given high praise after receiving the goods. Our products are of excellent quality, and we solemnly promise door-to-door delivery services worldwide. 4. We provide high-quality after-sales service aiming at customer satisfaction.

1. How to preserve peptides after receiving them?
Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder stored at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.
 2. What is your lead time and shipping method?
Customized items are negotiable. 1-3 working day after payment arranges the shipping. Parcels shipping by sea, by air, or by express (EMS, UPS, DHL, TNT, FEDEX, etc). 
3. Is the shipping 100% Guarantee?
Yes, we offer 100% Shipping Guarantee. If any seized parcel we will do resending. 

4. What payment methods do you support?
 Wise/Bank wire/BTC/USTD/alibaba/Paypal
5. Will I have any side effects after using peptide?
If you just begin to use, it is better to follow doctor's prescription. And if there is no allergy or any uncomfortable symptom, you can continue to use but take it in a suitable dosage. A few people will have slight allergy reaction, but after your body get used to it, the allergy will be disappear and back to normal.