 Home > Cosmetic Ingredient > Antioxidant Ingredient > LL-37 for Sale > LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers

LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers buy - large image1

LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers buy - image1

LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers buy - image2

LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers buy - image3

LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers buy - image4

LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers

TDS 4 Inquiries

Unit Price:

$20.2-25.25/G FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Research Grade

Content:

99.9%

Port:

GUANGZHOU

Brand:

Packaging:

5mg/vial

Sample Available:

Yes

Price valid (until):

2026-11-15

Contact Supplier

 Chat Now

Tianjin Huifeng Technology Co., Ltd.

Company Type:

Trader

Location:

China

Qualification:

Main Products:

peptides

 Visit Store

Product Details
Seller Information
History Price
Inquiry History

Description

Product Detail

Sales Manager: Mily

WhatsApp: +86 19943528714
+852 98534126

Email: sales04@yw-jl.c

Items	Specifications
CAS	154947-66-7
Appearance	White Powder
Purity (HPLC)	99.9%

Q1: Are you a supplier or a manufacturer?
A: We are both a supplier and a manufacturer.
Q2: How do you make the delivery?
A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
Q3: What payment methods do you accept?
A: We accept Alipay Bank Account USDT.
Q4: How about the after-sales service?
A: We offer high-quality products and guarantee 100% safe delivery.
Q5: How do you ensure product quality?
A: We will send you the analysis report (COA) of the sample to confirm the quality.
Q6: How can we verify the quality of the products before placing an order?
A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
Q7: Are there any discount offers?
A: Yes, the larger the order quantity, the more favorable the price will be.

Company Profile

Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information.
We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products.

1. Outstanding Product Quality
Product quality is the foundation of our business. Our peptide compounds are synthesized using the solid-phase peptide synthesis method (SPPS), purified by high-performance liquid chromatography (HPLC), and verified by mass spectrometry (MS).
Each batch of products comes with an analysis certificate (COA), which contains key data: ••• Purity (HPLC) • Molecular weight (MS) • • • Moisture content • • • Residual solvents • • Microbial limits (if applicable).
For customers with stricter regulatory requirements, we can also provide third-party testing reports, endotoxin (LAL) data, and stability study documents.
2. Customized Services and R&D Support
We provide flexible customized synthesis services and support from an experienced R&D team. Whether you need a new peptide sequence, cosmetic-grade purity, or modified molecules (such as PEGylation or acetylation), we can deliver high-quality products on time. Our services include:
•• Custom peptide synthesis (milligram to kilogram level)
••• Peptide modification and labeling
•• Small molecule synthesis
• Project-based R&D and large-scale production
We work closely with our clients to ensure technical feasibility, rapid delivery, and cost control throughout the entire development cycle.
3. Diverse product portfolio
We offer a wide range of products that are continuously expanding:
••• Peptides: GLP-1 analogues (such as sitagliptin, tazapetide, retactide, etc.), cosmetic-grade peptides (such as acetyl hexapeptide-8, Matrixyl, etc.), anti-aging peptides, and research-grade peptides.
•• Small molecule compounds: Cognitive enhancers, NAD+ precursors/promoters (such as NMN, NR, NADH) and intermediates.
• Biochemical products: Amino acid derivatives, enzyme cofactors, and custom reagents.
To meet the constantly changing market demands, we regularly introduce new products. At the same time, we also provide batch pre-order services for customers with continuous or seasonal demands.

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Research & Reference Note

LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Authoritative sources

Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Antioxidant Ingredient

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
peptides

Location:
No. 85, Qingnian Road, Hongqiao District, Tianjin

Total Annual Revenue:
$5 million-$10 million

Total Employees:
51-100

Year of Establishment:
2026
Weekly Price

 The chart shows the price trend of the product in the past 12 months.

Inquiry History

4 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
United States	LL-37	10 MG	Oct 17, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
The price is the factory price wu Sem PI5 BPC10mg,TB10mg,GHK-CU50 CND5 LC216 G5K	Cosmetics Grade/99	$1/G FOB	Chengtai Co., Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry
Wholesales peptides CAS 154947-66-7 LL37 5mg Peptide with high quatity	Pharmaceutical Grade/99	$65-80/UNIT FOB	Shaanxi TNJONE Pharmaceutical Co., Ltd	Inquiry
LL-37 Accurate Research Antimicrobial For Innate Immunity Defense Pathway Study	Cosmetics Grade/99	$100/MT FOB	Guangzhou Chunqiao Trading Co., Ltd.	Inquiry
LL37 high purity 99% Purity High Quality Peptide with factory price	Industrial Grade/99.99	$80/UNIT FOB	dashu	Inquiry

LL37 Discount price Factory Supply Peptide 99.9 purity Manufacturers

Product Details

Seller Information

History Price

Inquiry History

More Choices Find All Products for Sale 

Related Searches

More from this Seller