Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg
Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg buy - large image1
Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg buy - image1
Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg buy - image2
Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg buy - image3
Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg buy - image4
Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg buy - image5
Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg buy - image6

Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg

1 Inquiries

Unit Price:

$54/UNIT EXW

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Brand:

Crystchem

Packaging:

5mg/*10 vials; 10vials/ Unit

Price valid (until):

2026-08-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Pregabalin,Peptide,GHK-CU,Glutathione,NAD+

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 1

    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 2

    Our Reference Specification, for more details, pls contact us for COA, MSDS and certification:

    Email: ivy@crystchem.com     

    Telephone:+8613581787248

    Whatsapp&Wechat:+8613581787248


    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 3


    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 4

           Guangzhou Cryst Chemical Co., Ltd. is an outstanding chemical company dedicated to the processing of high-purity active pharmaceutical ingredientsd pharmaceutical intermediates, as well as the provision of global supply chain services. Based in Guangzhou, the company serves thedomestic and international pharmaceutical and fine chemical industries, offering customers compliant, stable, and efficient products and technical support.

    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 5
       
          Leveraging Guangzhou's well-developed logistics and foreign trade infrastructure, the company has built an efficient global delivery network. It is capable of providing customized suupply chain solutions to customers, including product development tailored to specific needds, small-scale trial production, large-scale deliveries, and technical consulting services. With its stable product quality, professional technical support, and fast-response service system,the company hasestablished long-term and stable partnerships with numerous pharmaceutical companies and chemical research institutions both in China and abroad.


    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 6

     We support  Wise, PayPal, T/T, Alipay and USDT.
    You can pick whichever payment method is more convenient for you.


    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 7


    ITEM  PACKAGE  INFO
    1 5mg*10vials, 10vials/set;  according to customer's detail requirement 


    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 8

    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 9
    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 10
    1.Safe and Fast Delivery. Most products are in ample stock. Upon payment confirmation, the goods can be shipped out promptly, and the tracking number as well as packaging details will be notified to you as soon as possible. Our products are exported in large quantiities to many countries including Germany, Brazil, the United States,Spain, the United Kingdom, France, Canada, Mexico, Poland, Russia, Australia, Norway and Finland, with a monthly output of over 10,000 kilograms. We have cooperating agents in all these countries. Our designated customs clearance company will ensure that your packages pass through customs smoothly. 

    2. Rich Experience. We are a professional manufacturer of pharmacecutical and chemical raw materials. Having focused on this field for rmany years, our products comply with BP, USP, EP and enterprise-grade standards. We guarantee that the purity of all our producis over 99%. High quality and purity are among the key secrets of our succand you can enjoy our top-tier services.

    3. High-quality Service. We provide enthusiastic 24-hour after-sales service and optimal delivery support. Feel free to contact your personal assistant, Gordon, at any time.

    Shop Ultra Pure LL37 LL-37CAMP Human Antimicrobial Peptide CAS 154947-66-7 99% White Powder 5mg-Detailed Image 11

    Q1. How do you ensure product quality?
    A: We have a strict quality management system, all batches must be tested and meet our standards before entering the warehouse. The purity of all our products is above 99.00%, which has been verified by many American and European customers.

    Q2. How to place an order with you?
    A: After confirming the dosage/strength and quantity of the required product with the customer, our business personnel will make a Proforma Invoice or Sales Contract. After the customer confirms and pays for the order, we will arrange shipment for the customer as soon as possible.

    Q3.Which payment is available for your company? 
    A: Paypal or Alipay or T/T or Bitcoins usdt trc usdt erc and so on.  You can choose the way which is convenient for you.

    Q4.May I get one sample before placing order? 
    A: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.Mutual effort towards each other.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Pregabalin,Peptide,GHK-CU,Glutathione,NAD+

    Location:

    Room B095, 1506, No.5 Jianzhong Road, Zhongshan Avenue, Tianhe District, Guangzhou

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Guangzhou Cryst Chemical Co., Lid. is an outstanding chemical company dedicated to the processing of high-purity active pharmaceutical ingredientspharmaceutical intermediates, as well as the provision of global supply chain services. Based in Guangzhou, the company serves thedomestic and international pharmaceutical and fine chemical industries, offering customers compliant, stable, and efficient products and technica support.

    Specializing in the pharmaceutical and chemical sector, the comparhy's main products include key raw materials and intermediates forvarious therapeutic areas such as analgesia, neuroregulation, antiviral therapy, and anti-infection treatments. Its core products include pregabalin and others. The company strictly adheres to the quality standarrmaceutical and chemical industry, establishing a comprehensive quality traceability system that covers all stages from raw material procurement, production control, to finished produact testing, ensuring that each batch of products meets the compliance requirements of both domestic and international customers.

    Leveraging Guangzhou's well-developed logistics and foreign tradeinfrastructure, the company has built an efficient global delivery network. It is capable of providing customized supply chain solutions to customers, including product development tailored to specific needs, small-scale triaduction, large-scale deliveries, and technical consulting services. With ie product quality, professional technical support, and fast-response service system, the company has established long-term and stable poartnerships with numerous pharmaceutical companies and chemicalresearch institutions both in China and abroad.

    In the future, Guangzhou Cryst Chemical Co., Ltd. will continue to focus oechnological innovation and product improvement in the pharmaceutical andI chemical field. Adhering to the business philosophy of "quality first, customer satisfaction above all," the company is committed tobecoming a trusted supplier of pharmaceutical and chemical raw meaterials for customers worldwide.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.