NAME: ANNA
WHATSAPP:+8619933210924
+852 5504 3622
EMAIL:sales02@yw-jl.cn
Welcome to concult
Manufacturer advantages
—— Basic Introduction ——
Name: LL37
CAS#: 597565-74-7
Molecular Formula: C209H317N53O43
Molecular Weight: 4516.38
Sequence: [LL-37, 37 aa]
Appearance: White Powder
Purity (HPLC): ≥99.0%
Single Impurity (HPLC): ≤1.0%
Moisture Content (Karl Fischer): ≤10.0%
Peptide Content: ≥80.0%
Storage: Store at -20℃ degrees Celsius in a dry and cool place.
Storage Condition: Store at -20°C
Solubility in DMSO: 3mg/mL
What is LL37 used for?
LL37 is a naturally derived human antimicrobial and immunomodulatory peptide. It supports bodily defense regulation, relieves abnormal inflammatory responses, and promotes skin and tissue repair. It is commonly applied in immune defense research, anti-inflammation studies and daily skin and physiological conditioning.
What does LL37 do to your body?
LL37 regulates immune responses and inhibits excessive inflammatory activity in the body. It enhances endogenous defense capacity, accelerates damaged tissue repair, and balances immune cell activity. It effectively alleviates persistent low-grade inflammation and improves weakened physiological defense states.
What effect can you get with LL37?
Long-term standardized use of LL37 stabilizes immune and inflammatory balance. It relieves inflammation-induced sub-health and poor tissue recovery, improving overall physiological stability. Featuring mild bionic regulation, it delivers safer, gentler and more reliable defense conditioning than traditional regulatory ingredients.
——Peptide Storage Guidelines——
When storing peptides, remember to:
• Store peptide in a cold, dry, dark place
• Avoid repeated freezing and thawing of peptide
• Avoid overexposure to the air
• Avoid light exposure
• Avoid storing peptides in solution long term
• Aliquot peptide according to experimental requirements
——FAQ——
Q1: Are you a supplier or a manufacturer?
A: We are both a supplier and a manufacturer.
Q2: How do you make the delivery?
A: We have established stable cooperative relationships with DHL, TNT, UPS, FedEx, EMS, China Post Air Express, etc. For container transportation, we can arrange for sea shipping; you can also choose your own freight forwarder.
Q3: What payment methods do you accept?
A: We accept Bitcoin and USDT.
Q4: How about the after-sales service?
A: We offer high-quality products and guarantee 100% safe delivery.
Q5: How do you ensure product quality?
A: We will send you the analysis report (COA) of the sample to confirm the quality.
Q6: How can we verify the quality of the products before placing an order?
A: For some products, free samples are available. You only need to bear the shipping cost or arrange for a courier to pick them up. You can also provide the product specifications and requirements, and we will produce them accordingly.
Q7: Are there any discount offers?
A: Yes, the larger the order quantity, the more favorable the price will be.
——Product Description ——
LL37 exhibits outstanding efficacy in immune modulation, inflammatory balance regulation and tissue repair protection compared with common bioactive peptide ingredients. As a high-activity endogenous defense peptide, it has high binding affinity for human immune and tissue receptors. This unique regulatory mechanism effectively relieves persistent inflammation, immune imbalance and slow tissue repair without causing physiological dependence or adverse side effects. Relevant pharmacological studies confirm that LL37 perfectly mimics natural human defense regulatory activity, safely and efficiently balancing immune responses, inhibiting abnormal inflammation and stabilizing bodily physiological functions. It is widely used in immune regulation research, tissue conditioning research and daily body regulation, providing a safe and natural alternative to traditional physiological adjustment methods.
——Company Profile——
Tianjin Huifeng Technology Co., Ltd. is a company specializing in the production of various peptide products and chemical raw materials. We have a professional R&D team and an efficient and reliable logistics team to ensure that you can receive high-quality products safely and on time. Our customers are located in the United States, Europe, Japan, South Korea, India, and other regions. Most of our main products are in stock and can be shipped immediately. Please inform us of your specific quantity requirements, and we will provide you with the most competitive prices. Welcome to contact us at any time for more information. We offer a wide range of peptide products, which are widely used in life science research, drug development, cosmetics, anti-aging medicine, and functional health supplements. We guarantee excellent product quality and competitive prices. Customers who have ordered our peptide products have always given high evaluations. We sincerely welcome reliable buyers from all over the world to contact us and negotiate business cooperation for peptide products. 1. Outstanding Product Quality Product quality is the foundation of our business. Our peptide compounds are synthesized using the solid-phase peptide synthesis method (SPPS), purified by high-performance liquid chromatography (HPLC), and verified by mass spectrometry (MS). Each batch of products comes with an analysis certificate (COA), which contains key data: ••• Purity (HPLC) • Molecular weight (MS) • • • Moisture content • • • Residual solvents • • Microbial limits (if applicable). For customers with stricter regulatory requirements, we can also provide third-party testing reports, endotoxin (LAL) data, and stability study documents. 2. Customized Services and R&D Support We provide flexible customized synthesis services and support from an experienced R&D team. Whether you need a new peptide sequence, cosmetic-grade purity, or modified molecules (such as PEGylation or acetylation), we can deliver high-quality products on time. Our services include: •• Custom peptide synthesis (milligram to kilogram level) ••• Peptide modification and labeling •• Small molecule synthesis • Project-based R&D and large-scale production We work closely with our clients to ensure technical feasibility, rapid delivery, and cost control throughout the entire development cycle. 3. Diverse product portfolio We offer a wide range of products that are continuously expanding: ••• Peptides: GLP-1 analogues (such as sitagliptin, tazapetide, retactide, etc.), cosmetic-grade peptides (such as acetyl hexapeptide-8, Matrixyl, etc.), anti-aging peptides, and research-grade peptides. •• Small molecule compounds: Cognitive enhancers, NAD+ precursors/promoters (such as NMN, NR, NADH) and intermediates. • Biochemical products: Amino acid derivatives, enzyme cofactors, and custom reagents.
——Payments —— We support payment methods including Alipay, bank cards and USDT
——Modes of transport ——
We offer global shipping via EMS and FedEx with full tracking and secure delivery to all regions worldwide.
| Items | Specifications |
| CAS number | 154947-66-7 |
| Purity | 99% |
| Appearance | White powder |
LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
Research & Reference Note
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
Indonesia
