Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder
LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder buy - large image1
LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder buy - image1
LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder buy - image2
LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder buy - image3
LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder buy - image4
LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder buy - image5
LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder buy - image6

LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder

TDS 3 Inquiries

Unit Price:

$70/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.99%

Port:

hongkong

Brand:

Yiwu Huangxin Trading Co., Ltd.

Packaging:

5mg/10vials

Price valid (until):

2026-11-21

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Polypeptide product

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Contact Us

    Yiwu Huangxin Technology Co., Ltd.

    WS:+852  4424  8557

    huangxin5188@qq.com

    Product Mechanism & Application 


    Certified High Quality: Our LL-37 peptide undergoes rigorous HPLC and Mass Spectrometry (MS) analysis to guarantee a purity of 98.0% or higher with excellent bioactivity.Yiwu's Global Logistics Edge: Located in Yiwu, the premier international trade hub, we offer unmatchable shipping flexibility, combining fast dispatch, safe clearance, and highly competitive shipping rates worldwide.Flexible Specifications: We cater to both small-scale research demands (1mg, 5mg, 10mg vials) and large-scale industrial bulk purchasing (grams to kilograms).End-to-End Trade Support: Yiwu Huangxin Trading provides 24/7 client communication, professional handling of custom documents, and secure tracking until the cargo reaches your laboratory door.

    Items Specifications
    Product Name LL-37 Peptide Powder
    Molecular Formula C205H340N60O53
    Purity (HPLC) ≥ 99.0% (Premium Grade)
    Storage Temperature Store at -20°C for long term; 2-8°C for short term stability
    Application Laboratory research use, metabolic disease studies, chemical intermediates

    Shop Semaglutide Peptide Factory Supply Semaglutide 2mg 5mg 10mg Vials Lyophilized Powder-Detailed Image 1

    Shop Tirzepatide CAS 2023788-19-2 with Safe Shipping to USA Europe Canada High Quality, Worldwide Shipping-Detailed Image 2


      Functions, Mechanisms, and Applications 


    A. Mitochondrial-Derived Signaling MechanismMost-c functions as a systemic mitochondrial hormone, translocating to the cellular nucleus during metabolic stress to regulate nuclear gene expression and activate cellular energy sensing:AMPK Pathway Activation: It robustly triggers the Adenosine Monophosphate-Activated Protein Kinase (AMPK) pathway, mimicking the positive effects of exercise and fasting on cells.Glucose Transport Optimization: It enhances GLUT4 (glucose transporter type 4) expression, speeding up cell-level glucose uptake independent of the standard insulin pathways.Fatty Acid Oxidation: It stimulates the clearance of lipids and increases fatty acid breakdown within the mitochondria, suppressing excessive fat accumulation.B. Primary Research ApplicationsLongevity & Cellular Anti-Aging Studies: Highly utilized in tracking the reversal of age-dependent metabolic decline, cellular senescence slowing, and physical performance preservation in old animal models.Insulin Sensitivity & Metabolic Syndrome: Provides essential data for researchers analyzing skeletal muscle insulin resistance and systematic glucose clearing.Mitochondrial Dysfunction Exploration: Acts as a prime research compound to investigate therapies for myopathies, age-related tissue degradation, and energy production deficits.Obesity & Weight Regulation Trials: Researched extensively to understand how alternative cellular mechanisms counter high-fat diet induced fat storage and increase lean mass ratios.

    Shop Tirzepatide CAS 2023788-19-2 with Safe Shipping to USA Europe Canada High Quality, Worldwide Shipping-Detailed Image 3
    Shop Tirzepatide CAS 2023788-19-2 with Safe Shipping to USA Europe Canada High Quality, Worldwide Shipping-Detailed Image 4


      Product Advantages & Quality Control  


    Why choose Retatrutide from Yiwu Huangxin Trading Co., Ltd.? We enforce rigorous scientific testing for every batch we export.
    • Ultra-High Purity: Our Retatrutide maintains a strict HPLC purity profile of over 99.0%, ensuring no interference from truncated peptide impurities during sensitive bioassays.
    • Perfect Lyophilization Technology: We utilize advanced vacuum freeze-drying techniques. The resulting cake has excellent solubility, rapid reconstitution, and long shelf-life stability.
    • Batch Consistency: Every single batch undergoes High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS) testing to verify exact molecular weight and sequence identity. COA (Certificate of Analysis) is provided with every shipment.
    • Zero Contamination: Our synthesis and packaging are conducted in Class 100,000 cleanrooms, minimizing endotoxin levels to meet global laboratory research prerequisites.

    Shop Tirzepatide CAS 2023788-19-2 with Safe Shipping to USA Europe Canada High Quality, Worldwide Shipping-Detailed Image 5

    Shop Semaglutide Peptide Factory Supply Semaglutide 2mg 5mg 10mg Vials Lyophilized Powder-Detailed Image 6

    Shop Most-c MOTS-c Peptide with Safe Shipping to USA Europe Canada-Detailed Image 7


      Company Introduction  


    Yiwu Huangxin Trading Co., Ltd. is a prominent and internationally active enterprise based in Yiwu City, Zhejiang Province, China—the world's largest capital of international trade and logistics. We are a specialized supplier dedicated to the procurement, quality evaluation, and international distribution of advanced pharmaceutical intermediates, biochemical reagents, and cosmetic peptide raw materials.
    Leveraging Yiwu’s unparalleled logistical ecosystem and our deep partnerships with top-tier domestic chemical synthesis laboratories, Yiwu Huangxin Trading Co., Ltd. has successfully bridged the gap between high-end chemical manufacturing and global client demand.
    Our team comprises experienced foreign trade professionals, quality assurance chemists, and logistics experts. We do not just sell chemicals; we deliver supply chain security. We strictly implement standard operating procedures (SOPs) for product verification, temperature-controlled warehousing, and compliant border clearance. Over the years, we have built a flawless reputation across North America, Europe, Australia, and Southeast Asia. We support flexible business models, including custom packaging, OEM vial labeling, and small-batch sample testing to accommodate both academic researchers and large-scale industrial buyers.

    Shop Tirzepatide CAS 2023788-19-2 with Safe Shipping to USA Europe Canada High Quality, Worldwide Shipping-Detailed Image 8
    Shop Tirzepatide CAS 2023788-19-2 with Safe Shipping to USA Europe Canada High Quality, Worldwide Shipping-Detailed Image 9


    Shipping, Packaging & Global Customs Logistics   


    International chemical logistics requires specialized expertise. Yiwu Huangxin Trading Co., Ltd. has engineered a worry-free delivery network to safeguard your investment.
    • Packaging Integrity: Standard packaging consists of heavy-duty, temperature-insulated foil bags with ice gel packs if required. For bulk orders, double-layered anti-static bags inside secure, discreet drums are used.
    • Discreet and Blind Shipping: We employ specialized, covert packaging options to guarantee smooth clearance through international customs frameworks without unnecessary delays.
    • Guaranteed Customs Clearance: We offer a 100% reshipment policy or alternative route routing for key destinations including the USA, UK, Canada, Germany, France, Netherlands, and Australia if any logistical customs disruption occurs.
    • Rapid Delivery Carriers: We partner with DHL, FedEx, UPS, EMS, and dedicated local air cargo lines to ensure door-to-door delivery within 5 to 12 business days globally. Tracking numbers are updated within 24 hours of dispatch.

    Shop Tirzepatide CAS 2023788-19-2 with Safe Shipping to USA Europe Canada High Quality, Worldwide Shipping-Detailed Image 10
    Shop Tirzepatide CAS 2023788-19-2 with Safe Shipping to USA Europe Canada High Quality, Worldwide Shipping-Detailed Image 11
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates
    • LL37 peptide Yiwu Huangxin Supply LL37 Antimicrobial Peptide Raw Material Powder Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Polypeptide product

    Location:

    Unit 2, Building 141, Lane 23, Dongliantang Village, Yiwu City, Jinhua City, Zhejiang Province, Room 305

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    366

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.