Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery
99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery buy - large image1
99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery buy - image1
99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery buy - image2
99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery buy - image3
99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery buy - image4
99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery buy - image5
99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery buy - image6

99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery

TDS 1 Inquiries

Unit Price:

$49/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hong Kong

Brand:

customizable

Packaging:

10 bottles per box

Price valid (until):

2026-08-23

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GHK-CU,RETATRUTIDE

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    email:wangolivia844@gmail.com

    whatsapp:+86 13188887140

    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 1


    Product Detail

    Made of premium raw materials with high purity and low impurity. It has stable physical properties and excellent water solubility. Rich in biological activity with mild and efficient effect, consistent batch quality and easy storage. Widely used in biological scientific research and related experiments with stable supply and reliable quality.

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses;

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity;

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.


    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 2

    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 3


    Company Profile

    Guangzhou Changkai Trading Co., Ltd. is a high-tech enterprise specializing in the research, production and sales of peptide products. With advanced laboratories and strict quality control systems, our products have obtained international certifications, ensuring safety and effectiveness.
    Our customers are located in Europe, the United States, Southeast Asia, the Middle East and other regions.
    As a global trading company, we provide customized solutions for customers in Europe, the United States, Southeast Asia, the Middle East and many other regions. Adhering to the concept of "Technology leads to health", we are committed to innovation and strive to provide high-quality health products for global consumers.
    Business philosophy
    Based on the domestic market, we have increased investment in research and development, produced high-quality products, and promoted environmental protection and sustainable development through technology. At the same time, we actively expand the international market, sincerely serve society, and strive to become a modern, environmentally friendly, and advanced technology enterprise with global standards. Contact Us

    Our products have been exported to 130 countries and regions. We are committed to establishing stable, strategic and long-term partnerships with both domestic and international suppliers and customers, working together to create a brighter future.


    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 4

    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 5


    Frequently Ked Question

    1. We are the source factory of materials, offering high quality and high purity with wholesale prices.
    2. We can deliver to any region, with dedicated delivery services, ensuring safety and speed.
    3. You can communicate with us for any product. Our products are diverse and we support customization to meet your needs as much as possible.
    4. We support various payment methods, and all details can be discussed.
    5. You can contact me for any questions. I will do my best to answer them for you.

    6 Price : We do not engagein price wars. Our first quotation may too expensive to you, please don't lose heart. Firstly, our quality can be guaranteed; Secondly, our tranportation efficiency and custome clearance rate can be guaranteed; Thirdly, we will provide you with the highest quality service, in any aspect.

    You get what you pay off, if you have any questions, i will have the answer.


    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 6

    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 7

    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 8

    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 9


    Type of Shipping

    We mainly adopt dedicated logistics and FedEx transportation methods, which can ensure the timeliness of shipment, rapid delivery, stable logistics tracking, and safe and punctual delivery.


    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 10

    Shop 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery-Detailed Image 11

    Items Specifications
    LL-37 10 bottles per box
    content 99%
    unit of measurement mg

    Certificates
    • 99% Purity LL-37 Factory Wholesale Low Price Hot sale white powder LL-37 peptide Weight Lose Fast Delivery Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GHK-CU,RETATRUTIDE

    Location:

    Guangzhou Changkai Trading Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Employees:

    Less than 5

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.