Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > FOXO4-DRI for Sale > FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock
FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock buy - large image1
FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock buy - image1
FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock buy - image2
FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock buy - image3
FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock buy - image4
FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock buy - image5
FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock buy - image6

FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock

TDS 26 Inquiries

Unit Price:

$10-11/MT FOB

Get Latest Price
CAS No.:

2460055-10-9

Grade:

Pharmaceutical Grade

Content:

99%

Port:

guangzhou

Brand:

zwxs

Packaging:

5mg/vials,10vials/box

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    we sale full list with peptide products , any other requirements just contact me!

    Name:Molly

    email: zwxs5@zwxstech.com

    whatsapp/wechat: +86 15100979596

    Product Description :

    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

    Function & Application:

    FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

    Appearance: Powder

    Purity: >98% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    HS Tariff Code: 2934.99.9001

    Product Specification :

    Product Name 99%  Powder Peptide FOXO4-DRI CAS 2460055-10-9 Lyophilized Powder FOXO4 GHK-CU DSIP TIRZ Sem
    Product Name FOXO4
    CAS 2460055-10-9
    MF FOXO4
    EINECS NO FOXO4-DRI
    Purity 99.8%
    Delivery 8-10Days
    Production Capacity 10 Tons/Month
    Payment method
    USDT,BTC,PAYPAL,ALIBABA,BANK TRANSFER,CREDIT CARD.ETC.
    Transport Package TNT, DHL, FedEx, UPS, EMS
    Shelf Life 2 Years


    Shop FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock-Detailed Image 1

    Shop FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock-Detailed Image 2 Shop FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock-Detailed Image 3 Shop FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock-Detailed Image 4 Shop FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock-Detailed Image 5

    Our customers are all over the world, mainly selling in the United States, Canada, Australia, the United. Kingdom, the Ne  therlands, Germany, France and other EU countries, Southeast Asia, South America, and Oceania. We also have many customers.
     Our business is based on honesty and mutual trust. Sincerely look forward to establishing long-term mutually beneficial business relationships with customers around the world. Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 6

    Shop FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock-Detailed Image 7 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 8

    Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 9 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 10 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 11

    We supply large quantities of peptides.In addition to regular specifications, we can also customize according to customer requirements.
     The minimum order quantity is 1 box(10vials), we welcome customers to order samples for testing.Please contact us for COA or HPLC.
     We believe that as long as the quality is good enough will lead to long-term cooperation.Looking forward to your inquiry.

    Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 12 Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 13


    Shop Anti-Aging Raw   white Powder Epithalon Peptide Raw Powder-Detailed Image 14

    packaging and shipping

    Suitable packaging:
    The packing suits you best would be choosen to cross customs safely. Or if you have your own ideal way, it could be also taken in consideration

    Secure shipping:
    Shipping by professional forwarder Security EMS/DHL/TNT /FedEx/UPS, Aus Post, Royal Mail express,etc. Door to door service.

    Competitive prices:
    A discount would be given when you make a large order. VIP price for next orders.

    FAQ

      Q1:How to send order?
      A:Send order list to us,we quote best price for you,then ship package out and offer tracking nubmer to you after payment send.

      Q2:Do you have samples for our reference?
    A:Sure,we can offer smaples,the customers will pay the freight.

      Q3:Any discount if order more?
    A:Sure,the price is negotiable,you can get much better price if order big quantity.

      Q4:What about the delivery time?
    A:Ship within 1-2 days after confirming payment (excluding Chinese holidays).5-10 working days to arrive your address.

      Q5:What kind of payment terms do you accept?
    A:Payment can be made by Bank transfer, BTC,Credite Card,TT,Paypal,Alipay,Wechat,Visa,Mastercard,Appple Pay,Goolge Pay.

    Our Advantage                                                                                              

    1. Product Quality Assurance: We maintain stringent quality standards. Contact us for quality-related issues.

    2. Returns and Refunds: Notify us of damaged or incorrect products. Refer to our Returns and Refunds Policy.

    3. Technical Support: Reach our technical support team for assistance.

    4. Order Tracking: Receive tracking information for your order.

    5. Customer Feedback: Share your feedback with us.

    6. Updates and Notifications: Subscribe to our newsletter for updates.

    Shop FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock-Detailed Image 15



    Certificates
    • FOXO4 CAS: 2460055-10-9 Wholesale Price -Dri Foxo4 Dri Peptide Foxo4-Dri Powder in Stock Certificates 1

    Basic Info
    Product Name:

    FOXO4-DRI

    Other Name:

    FOXO4-DRI;FOXO4 /FOXO4-DRI;FOX04-DRI (D-Retro-Inverso);Fox4-dri

    CAS No.:

    2460055-10-9

    Molecular Weight:

    0

    Color/Form:

    White to off-white

    Characteristics
  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    No. 41-9, Fenghuangshan Road, Beiyuan Street, Tianqiao District, Jinan City, Shandong Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    26 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    FOXO4-DRI

    1 G Dec 3, 2023
    United States

    Fox04-dri

    1 G May 20, 2026
    United States

    hot-sale-high-purity-raw-powder-fox04-dri-nad-ghk-cu-mot

    2 PCS Dec 19, 2025
    United States

    foxo4 dri

    10 MT Dec 13, 2025
    United States

    Fox04

    10 MG Oct 30, 2024
    United Kingdom

    High purity foxo4

    1 G May 31, 2026
    United Kingdom

    Foxo4-Dri

    10 MG May 5, 2026
    United States

    Fox04-dri

    100 MG Apr 28, 2026
    Cyprus

    Foxo4 dri

    10 MT Apr 4, 2026
    Cyprus

    FOXO4-DRI

    1 KG Feb 2, 2026
    United States

    FOX04-DRI

    10 PCS Jan 12, 2026
    United States

    FOX04

    10 PCS Jan 12, 2026
    United States

    Foxo4 Dri

    40 MG Sep 15, 2025
    United States

    Fox04 dri

    10 MT Jun 21, 2026
    United States

    FOX04-DRI powder

    10 MT May 29, 2026
    United States

    fox04

    1 G Apr 29, 2026
    United States

    FOXO4-DRI

    1 KG Mar 23, 2026
    United States

    Foxo4-Dri

    Nov 24, 2025
    United States

    FOXO4

    10 PCS Nov 15, 2025
    United States

    Fox04

    1 G Nov 10, 2025
    • 1
    • 2
    • Go to Page Go
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.