Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support buy - large image1
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support buy - image1
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support buy - image2
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support buy - image3
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support buy - image4
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support buy - image5
LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support buy - image6

LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support

TDS 3 Inquiries

Unit Price:

$50-60/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

Topi

Packaging:

5mg/vial, 10vials/box

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides,Semagiutide,Retatrutide,GHK-CU,MOTS-c,Semax

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail 


    Sales: Sophia
    Mail: 16632958910@163.com   
    Whatsapp: +852 60438729

    we sale full list with peptide products , any other requirements just contact me !!!

    Items Specifications
    Product Name LL37
    Grade Pharmaceutical Grade
    CAS NO. 154947-66-7
    Function Antibacterial properties
    Appearance White Powder


      Product Detail  


    LL-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.

    The human body mainly produces two types of antimicrobial peptides: defensin family peptides and cathelicidin family peptides. Although there are many members of the defensin family of peptides, cathelicidin has only one antimicrobial peptide product, LL-37. LL-37 is the C-terminal cleavage product of cathelicidin peptide Hcap-18, which directly kills bacteria, fungi and viruses.


    • 1、Antimicrobial Activity:
    • Primarily through the "carpet-like" model or "toroidal pore" formation in microbial membranes, causing membrane disruption and cell lysis. Its cationic nature interacts with negatively charged microbial membranes, while hydrophobic residues allow insertion into lipid bilayers.
    • 2、 Immune Modulation (Dual Role): Pro-inflammatory Effects / Anti-inflammatory Effects
      • 3、 Other Key Functions:
        Wound Healing: Promotes re-epithelialization, angiogenesis, and tissue repair
        • Antitumor Activity: Inhibits cancer cell proliferation and migration, induces apoptosis
        • DNA/RNA Interactions: Forms complexes with nucleic acids, stimulating plasmacytoid dendritic cells to produce type I interferons
        • Anti-biofilm: Disrupts established biofilms and prevents new formation


        • Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 1
    • Shop Factory Supply LL 37 CAS 154947-66-7 High quality LL-37 peptide powder The Human Cathelicidin Antimicrobial Peptide-Detailed Image 3

    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 3


    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 4 Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 5 Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 6


    Product photo


    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 7 Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 8 Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 9




    Details

    Appearance: Powder

    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 10 Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 11


    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 12 Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 13



    Peptide packaging


    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 14


    Product transportation


    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 15


    Payment modes  


    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 16


      Company Profile 


    Hainan Terte New Materials Co., Ltd. It is located in Hainan Province, China, with well-developed land transportation and convenient sea transportation. We focus on the sales and practical application of chemical raw material products. We adhere to the business philosophy of "be a good person first, then do good deeds", with the aim of putting customers first, ensuring stable and reliable quality, and promoting honest cooperation. We provide services to enterprises across the country with enthusiastic service and reasonable prices. Our company warmly welcomes domestic and foreign merchants and friends to visit and patronize us. We are willing to join hands with friends from all walks of life to create a brilliant future together.

    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 17 Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 18 Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 19

    Shop LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support-Detailed Image 20


     FAQ


    1.Can we get your free samples?

    Yes, can. Our free sample can be provided for customers test. But the freight for express is obuyer's account.

    2.Can we do printing or label on the bottles?

    Yes, can. We can offer various printing ways,such, screen printing, hot stamping, label printing.

    3.What is the normal lead time?

    For stock products, within 24-48 hours after we receive your payment. For smaller customize color bottles, we will ship out within 3-5 days.

    4.What is your shipping terms?

    Faster ways: FEDEX, DHL, UPS, TNT, etc by sea or by air economy

    5.What payment methods are there?
    There are Bank Transfer, PayPal, Tether USD(USDT) and Bitcoin(BTC); we can also accept payments in CNY, for example, through Alipay or WeChat.

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    LL-37 CAS:154947-66-7 High-quality anti-inflammatory neuroprotective peptides for immune support is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides,Semagiutide,Retatrutide,GHK-CU,MOTS-c,Semax

    Location:

    Units 1503-14, 15th Floor, New HNA Building, No. 7 Guoxing Avenue, Lantian Subdistrict, Meilan District, Haikou City, Hainan Province

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    101-200

    Year of Establishment:

    2025

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.