Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance
LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance buy - large image1
LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance buy - image1
LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance buy - image2
LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance buy - image3
LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance buy - image4
LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance buy - image5
LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance buy - image6

LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance

TDS 3 Inquiries

Unit Price:

$2/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

ShenZhen

Brand:

Tong Peptide

Packaging:

10vials/box

Price valid (until):

2026-09-25

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

retatrutide,TB-500,GHK-CU,peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Name: Tina

    Whatsapp: +852 6576 7865

    Email: tina@tongpeptides.com


    Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 1

    Items Specifications
    Product name

    LL37-375-10mg

    CAS NO.   

    154947-66-7

    Purity 99.9%
    Packaging 10mg* 10vials/box
    Payment term Bitcoin and Wise transfer
    Delivery time within 48 hours after payment
    MOQ 10vials
    Shelf life  3 Years
    Appearance Powder

     

    Main peptides

    The company's main peptide products, a variety of products, covering beauty peptides, weight loss peptides and tanning peptides and other fields. We are committed to translating the latest scientific research results into highly effective and safe peptide products that meet the diverse needs of our customers.

     Beauty peptide

    Beauty peptide is one of our special products, with its efficient and safe characteristics, favored by the majority of consumers. Beauty peptides can promote the production of skin collagen, improve skin elasticity, reduce wrinkles and fine lines, and make skin smoother and more delicate. In addition, beauty peptides also have antioxidant, anti-inflammatory and other effects, which can effectively fight against the damage of the external environment to the skin and delay the aging process.

     Weight loss peptides

    Slimming peptide is an important product for modern people to pursue health and beauty. The weight loss peptides we developed can help consumers achieve healthy weight loss by regulating the body's metabolism, suppressing appetite, accelerating fat decomposition and other ways. Weight loss peptides can not only effectively reduce body fat, but also maintain muscle mass and avoid problems such as skin sagging during weight loss.

    Tanning polypeptide

    Tanning peptides are products that promote the production of melanin in the skin, helping consumers achieve a healthy, natural tan. Tanning peptide by stimulating the activity of skin melanocytes, make the skin gradually dark, but also has a certain sunscreen effect, reduce the damage of ultraviolet light to the skin. Our tanning peptides are easy to use and effective, making them the ideal choice for consumers looking for a tan.Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 2 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 3 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 4 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 5 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 6 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 7

    Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 8

     

    Product Efficacy:
    As a premium cosmetic peptide for daily skincare formulas, Semaglutide effectively improves skin metabolic circulation, repairs fragile skin barrier and boosts collagen activity. It helps smooth fine lines, enhance skin elasticity and lock skin moisture. With mild and stable activity, it balances oily skin condition and delivers long-lasting, healthy skincare effects for various beauty products.


    Lyophilized powder product information with document-first communication, COA-related support, discreet shipping, and private WhatsApp inquiry.

       Our products are third-party tested with reliable quality and purity.We have full customs clearance and insurance for the entire shipment.Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 9 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 10


     
    FAQ

    1.Do you ship internationally?

    Worldwide shipping options may be available depending on destination, product category, and local import rules. Please confirm your country with our team first.

    2.How should customers confirm legality?

    Customers are responsible for confirming that import, possession, research use, or any other intended use is lawful in their jurisdiction before requesting shipment.

    3.Can I request COA before confirming details?

    Yes. You can request available batch documentation, product information, and shipping details through WhatsApp before you confirm the order request.Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 11 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 12 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 13

    Super fast delivery and receipt time,only five or six daysShop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 14 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 15

          All our peptides are e with certified high purity, reliable stable quality that cheap suppliers can’t match.
         We take full responsibility for customs clearance to avoid detention troubles for you.Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 16 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 17 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 18

    Our Services

    1.Strictly control the process from raw materials to finished products.

    2.Customer first, we provide reasonable price, high quality products and timely delivery.

    3.Our delivery method is safe and fast.

    4.Quickly and clearly answer customer 's questions.

    If you place a large number of orders with us, we can give a price discount.Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 19 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 20

    Our advantage:

    Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.
    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales workShop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 21 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 22

    Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 23 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 24 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 25

    1. We are the source factory of materials, offering high quality and high purity with wholesale prices.
    2. We can deliver to any region, with dedicated delivery services, ensuring safety and speed.
    3. You can communicate with us for any product. Our products are diverse and we support customization to meet your needs as much as possible.
    4. We support various payment methods, and all details can be discussed.
    5. You can contact me for any questions. I will do my best to answer them for you.

    6 Price : We do not engagein price wars. Our first quotation may too expensive to you, please don't lose heart. Firstly, our quality can be guaranteed; Secondly, our tranportation efficiency and custome clearance rate can be guaranteed; Thirdly, we will provide you with the highest quality service, in any aspect.

    You get what you pay off, if you have any questions, i will have the answer.Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 26 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 27 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 28 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 29 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 30 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 31 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 32

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirementsShop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 33 Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 34

    Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 35


    Why choose us?  

    Our Advantages.

    1.High quality with competitive price.
    2. All purity>99%.
    3. We are manufacturer and can provide high quality products with factory price.
    Fast and safe delivery.
    1. Parcel can be sent out in 24 hours after payment tracking number available.Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 36
    2. Secure and discreet shipment verious transportation methods for your choice.
    3. Customs pass rate >99%.

    We have clients throughout the world.
    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.
    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.
    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.Shop LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance-Detailed Image 37

      How to make an order?

    Send me message and let me know what you need with quantity , then i will calculate to you.

    WhatsApp+85265767865
    Email:tina@tongpeptides.com
    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • LL37|375|Wholesale Price|China Factory Direct Supply|High 99% Purity|Fast and Safe Shipping|On Time Arrival|Customs Clearance Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    retatrutide,TB-500,GHK-CU,peptide

    Location:

    1-1, Kailuo Road, Taojia Town, Jiulongpo District, Chongqing

    Payment Terms:

    TT against copy of documents,L/C,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    501-1000

    Year of Establishment:

    2023

    Pharma Grade Peptides is your premium source for high-quality purified research peptides.

    We have served over 20,000 customers on Alibaba and now offer the same quality at our independent store.

    Over the course of many years, we have empowered researchers and scientists to
    explore new avenues of scientific discovery.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.