Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available
375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available buy - large image1
375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available buy - image1
375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available buy - image2
375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available buy - image3
375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available buy - image4
375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available buy - image5
375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available buy - image6

375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available

1 Inquiries

Unit Price:

$81-105/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

kangtaiLL-37 is the only human cathelicidin antim

Packaging:

10mg/vial 10vial/kits

Price valid (until):

2027-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Polypeptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Description

                                sales:senven Qin

                            Whatsapp:+44 7564 050160

                            Email:329379139@qq.com

                sincerely look forward to your inquiries about our products.

    Items Specifications
    Product Name 375    LL375
    CAS No. 154947-66-7
    Packaging 10mg/vial 10vial/kits
     inimum order quantity 1 box(10vials)
     Grade Cosmetics Grade
    Content 99%
    Storage Dry Cool Sealed Container
    Before placing an order Please inform us of the types and quantities of the goods you need.
    Send the quotation We will send you a detailed quotation sheet including the total amount.
    after-sales service Available at any time



                                        About Us KANGTAI Company Profile

    Kangtai is a modern biopharmaceutical raw material enterprise with deep research and development, large-scale production and global supply of biopeptide raw materials. It has long focused on the whole industrial chain layout of functional peptides, medical active peptides and metabolic management peptide raw materials. It has independent peptide synthesis laboratory, standardized clean production workshop and complete three-level quality inspection center.
    The core team of our company is composed of professional and technical personnel of biochemistry, peptide synthesis and pharmaceutical preparations. We have accumulated rich practical experience in solid-phase synthesis, purification, freeze-drying and stable preparation development of long-chain peptides. We are proficient in the process optimization of GLP-1 / GIP target peptides, and can stably produce high-purity tierpo peptide and other weight-loss metabolic active peptide raw materials.
    The whole production process follows the ISO9001 quality management system and cGMP production specification, and establishes a full-link control standard from raw material storage, synthesis and purification, liquid phase quality inspection, aseptic freeze-drying to finished product packaging. It can provide standardized high-purity polypeptide raw materials, customized synthesis and technical formula matching one-stop service for domestic and foreign pharmaceutical research and development institutions, health preparation factories and biological research laboratories. The products are long-term supply to the domestic and foreign scientific research and preparation development market, and have been recognized by long-term cooperative customers with stable purity, batch consistency and perfect quality inspection report.


    Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 1 Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 2 Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 3


                                                               Product Detail  

    LL-37  is the only human cathelicidin antimicrobial peptide, a 37-residue cationic peptide derived from hCAP18. It exhibits broad-spectrum antimicrobial activity against Gram-positive/negative bacteria, fungi, and enveloped viruses, with low resistance risk. It modulates immune cell chemotaxis, cytokine release, and inflammation. It promotes angiogenesis and wound healing, and inhibits tumor growth. For research & cosmetic use only. Store at -20°C with cold-chain transport.


    Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 4 Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 5


                                                                                      Why did you choose us.

    We are a professional peptide supplier, offering four key advantages: high-purity products, efficient and safe global logistics, flexible and convenient payment methods, and a professional and dedicated team - all of which are designed to help your business reach a higher level.

    Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 6 Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 7



    We collaborate with numerous leading logistics companies worldwide. Our global transportation network guarantees that our safe and efficient logistics services can meet your urgent needs.

    Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 8


                                                                   Product Storage

    For optimal stability and activity preservation, store HX2 HX5 HX10at -20°C or below in a dry, dark environment. Avoid repeated freeze-thaw cycles, as this may degrade the peptide structure. For long-term storage (over 6 months), we recommend aliquoting the peptide into smaller portions and storing them at -80°C. Before use, allow the vial to reach room temperature, then reconstitute the peptide with sterile water or bacteriostatic water according to your specific research requirements.


    Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 9 Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 10


                                                                      FAQ

    Question: What are the delivery time and transportation method?

    Q1: How long is your delivery time?
    A: For the US, it's 7-15 days. For other regions, it depends on the country's location. (We ship after payment)

    Q2: How can I contact you?
    A: Contact us via email or WhatsApp. Average response time during working hours is 0-8 hours, and less than 24 hours outside working hours.

    Q3: How do you handle quality complaints?
    A: We have a strict quality management system. All batches must be tested and meet our standards before storage. Non-conforming materials won't be delivered to customers. If any quality issue is confirmed to be our fault, we will immediately replace the goods or issue a refund.

    Q4: What is your minimum order quantity?
    A: For most products, the minimum order quantity is 1 box.

    Q5: What shipping method do you use?
    A: Courier delivery.

    Q6: What payment methods do you accept?
    A: Alibaba, Alipay, USDT, WISE.


    Shop 375 LL37 | Peptide for Advanced Research | 99% Purity | Lyophilized Powder | High Quality / Bulk Discounts Available-Detailed Image 11


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Polypeptide

    Location:

    Room 205-E742, Building F, No. 53 Congyun Road, Huangshi Street, Baiyun District, Guangzhou City

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.