Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > FOXO4-DRI for Sale > FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging
FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging buy - large image1
FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging buy - image1
FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging buy - image2
FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging buy - image3
FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging buy - image4
FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging buy - image5
FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging buy - image6

FOXO4-DRI Peptides Raw Powder CAS 2460055-10-9, Top Quality 99% Purity, Best Price with Bottle Packaging

TDS 26 Inquiries

Unit Price:

$10/G FOB

Get Latest Price
CAS No.:

2460055-10-9

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

Tranmoo

Packaging:

10mg*10vials

Price valid (until):

2027-02-13

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Contact Information:
    WHATSAPP:+8615875350252

    EMAIL:cting7458@gmail.com

    please add my WhatsApp account to receive more product catalogs!


    1. Company Introduction:

    Our company specializes in exporting various chemical products, including chemical raw materials, a full range of peptide products.

    We will provide you with high quality products at the best offer. Professional transportation, convenient and safe, door-to-door delivery.

    Customers who have ordered our products(peptides)have had very good feedback.

    World wide relaible buyers can contact us about the peptides.

    2. Product Description:
    FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

    3. Key Categories:

    - Cosmetic Peptides: Acetyl Hexapeptide-8, Copper Peptide GHK-Cu, Pentapeptide-4, SNAP-8
    - Pharmaceutical Peptides: Semaglutide, Tirzepatide, Thymosin Alpha-1, Epithalon

    4. Specifications:

    Purity: >98% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    HS Tariff Code: 2934.99.9001



    5.  Applications:
    FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

    6. Why Choose Us:

    Rich Industry Experience:

    1. We are a long-established leading professional manufacturer in China’s pharmaceutical industry. Our products are exported to Germany, Spain, the United Kingdom, the United States, Australia, the Middle East and numerous other regions worldwide. We have received consistent positive feedback from clients and built long-term, amicable cooperative partnerships.

    2. Superior Quality, High Purity & Competitive Pricing:
    3. Premium quality is the core of our competitive advantage. Sample orders are welcome, with a minimum order quantity (MOQ) of only 1 gram.

    4. Secure & Expedited Delivery:
      We maintain sufficient in-house inventory, enabling same-day shipment upon receipt of payment.

      We have dedicated logistics channels for shipments ranging from 0.01 kg to 3.5 kg per consignment. We also provide custom dissolving service to convert solid powder into liquid formulations, which will be packed in specialized sealed bottles for transportation.

    5. Comprehensive After-sales Support:
      We will proactively update you with real-time shipping tracking information. Our team will make every effort to resolve any issues our customers may encounter.

    Contact us for best quotation!



    7. peptides have obvious advantages:

    Many active substances in the human body are in the form of peptides.

    Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.





    8.Main Functions & Benefits

    Senescent Cell Clearance: Research suggests that senescent cells accumulate in the body with age and contribute to age-related decline and diseases. FOXO4-DRI is designed to selectively target and induce the death of these senescent cells while sparing healthy cells. By promoting the clearance of senescent cells, it aims to potentially mitigate age-related conditions.

    Preclinical Studies: Studies conducted in animal models have shown promising results regarding the clearance of senescent cells and potential health benefits associated with reduced senescent cell burden. These studies have indicated improvements in various age-related conditions and tissue function.

    Experimental Nature: Despite its potential benefits in preclinical studies, the use of FOXO4-DRI remains largely experimental. Comprehensive human studies regarding its safety, efficacy, and long-term effects are limited.

    Safety and Efficacy in Humans: As of now, the safety profile and potential side effects of FOXO4-DRI in humans are not well-established due to the lack of comprehensive human trials. There's a need for further research to evaluate its safety, optimal dosage, and potential applications in human health.






    FAQ:

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: How do I start paying?
    Payment methods: USDT, Paypal Bitcoin, bank transfer, Alipay, and WeChat Pay.

    Q3: How to confirm product quality before placing an order?
    You can send us your product specifications and requirements and we can customize for you.

    Q4: What is your MOQ?
    A: The minimum quantity we can order is 1 box.

    Q5: How is the quality I want to test.
    A: Before production and extraction, we will test all raw materials.Quality is our top priority.All products are strictly tested and confirmed by our QC and QA, approved by Third Party Lab in China.So you will be assured with Good Quality if you choose us. We welcome you test the product and hope to get your feedback.

    Q6 : Have you received my payment How long will it take
    A: Generally, we can receive your payment the next day, and we will inform you as soon as we receive your payment.
    After confirmation payment, we will send out package

    Q7:When will you sent out the goods after successful payment
    A: Normally the order will be delivery within 1-3 days after the order confirmed, except the customized products.

    Q8:What modes of transportation do you have to choose
    A: We cooperate with HKEMS, DHL, TNT, UPS, FEDEX, EMS, China Air Post ,sea transportation etc.
    And with the SAFE SHIPPING in each country, you can receive the goods smoothly.It is fast and safe method.

    Q9:How long does it take to the goods arrived
    A: It is Depending on your location:
    For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, HKEMS,Netherlands post.
    For large order, please allow 5-8 days by Air, 20-35 days by Sea
    At the same time, we have warehouses in Germany and California, and some orders can be sent directly from Germany or California.

    Q10: How is the goods packed
    A: We usually send goods with disguise package outside and a double-layer sterile transparent bag inside.We have tried thousand of package methods, it looks serious and discreet.


    Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 1 Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 2 Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 3 Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 4 Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 5 Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 6

    Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 7 Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 8 Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 9
    Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 10
    Shop FOXO4-DRI CAS 2460055-10-9 Senolytic Research Peptides High Purity Lyophilized Powder, lab reagent for cell senescence in vitro laboratory research-Detailed Image 11

    Items Specifications
    Before ordering Please send what items and what quantity you need
    Send quotation We will send you a quotation in detail with total
    Payment ways chosen Please choose one of the payment way you preferred.
    Payment methods: USDT, Bitcoin, bank transfer, Alipay, and WeChat Pay.
    After payment Please offer shipping address after payment for shipment.
    Tracking We will provide the tracking after goods sent
    After-sale service Available always



    Certificates

    Basic Info
    Product Name:

    FOXO4-DRI

    Other Name:

    FOXO4-DRI;FOXO4 /FOXO4-DRI;FOX04-DRI (D-Retro-Inverso);Fox4-dri

    CAS No.:

    2460055-10-9

    Molecular Weight:

    0

    Color/Form:

    White to off-white

    Characteristics
  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide

    Location:

    shenzhenshilonggangqulongchengjiedaohuanggekengshequjiazhaoyeshidaidasha902

    Average lead Time:

    15

    Year of Establishment:

    2024

    Shenzhen Chuanmu Technology Co., Ltd .

    Shenzhen Chuanmu Technology Co., Ltd. stands at the forefront of the biotechnology industry as a specialized leader dedicated to the research, development, and sales of high-purity, bioactive peptides. We integrate cutting-edge scientific innovation with an unwavering commitment to quality, serving a global clientele across pharmaceuticals, cosmetics, nutraceuticals, and research institutions.

    Driven by a mission to harness the power of peptides for health and advancement, our core strength lies in our advanced R&D capabilities. Our team of expert scientists utilizes state-of-the-art synthesis, purification, and analytical technologies to produce peptides of exceptional purity, consistency, and biological activity. We offer a comprehensive portfolio, including custom peptide synthesis, catalog peptides, generic APIs, and novel peptide-based formulations tailored to specific client requirements.

    Quality and reliability are the bedrock of our operations. Our processes adhere to the most stringent international standards, ensuring every product meets rigorous specifications for safety and efficacy. We are more than just a supplier; we are a strategic partner, providing robust technical support, confidential collaboration, and scalable solutions from preclinical stages to commercial production.

    Based in the dynamic innovation hub of Shenzhen, China, Shenzhen Chuanmu Technology is poised to accelerate your next breakthrough. We empower our partners to pioneer new treatments, enhance product performance, and push the boundaries of scientific discovery.

    Our Promise: Precision in Every Chain. Innovation for a Healthier Future.

  • Inquiry History
    26 Inquiries
    Country Product Purchase Quantity Date Posted
    United States

    FOXO4-DRI

    1 G Dec 3, 2023
    United States

    Fox04-dri

    1 G May 20, 2026
    United States

    hot-sale-high-purity-raw-powder-fox04-dri-nad-ghk-cu-mot

    2 PCS Dec 19, 2025
    United States

    foxo4 dri

    10 MT Dec 13, 2025
    United States

    Fox04

    10 MG Oct 30, 2024
    United Kingdom

    High purity foxo4

    1 G May 31, 2026
    United Kingdom

    Foxo4-Dri

    10 MG May 5, 2026
    United States

    Fox04-dri

    100 MG Apr 28, 2026
    Cyprus

    Foxo4 dri

    10 MT Apr 4, 2026
    Cyprus

    FOXO4-DRI

    1 KG Feb 2, 2026
    United States

    FOX04-DRI

    10 PCS Jan 12, 2026
    United States

    FOX04

    10 PCS Jan 12, 2026
    United States

    Foxo4 Dri

    40 MG Sep 15, 2025
    United States

    Fox04 dri

    10 MT Jun 21, 2026
    United States

    FOX04-DRI powder

    10 MT May 29, 2026
    United States

    fox04

    1 G Apr 29, 2026
    United States

    FOXO4-DRI

    1 KG Mar 23, 2026
    United States

    Foxo4-Dri

    Nov 24, 2025
    United States

    FOXO4

    10 PCS Nov 15, 2025
    United States

    Fox04

    1 G Nov 10, 2025
    • 1
    • 2
    • Go to Page Go
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.