Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7
LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7 buy - large image1
LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7 buy - image1
LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7 buy - image2
LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7 buy - image3
LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7 buy - image4
LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7 buy - image5
LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7 buy - image6

LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7

TDS 1 Inquiries

Unit Price:

$56-67/UNIT EXW

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

hebei

Brand:

SDR

Packaging:

Bottled

Price valid (until):

2026-09-30

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides,Semagiutide,Retatrutide,GHK-CU,MOTS-c,Semax

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Introduction  


    Items Specifications
    Packaging method Bottled
    Purity 99%
    Product abbreviation LL37/375
    Dosage 5mg*10vials

    LL-37 Peptide (CAS 154947-63-6) is synthetic human cathelicidin peptide. We supply cosmetic grade and research grade LL37 powder with high purity. Stable activity, good solubility, complete COA documentation. Bulk order & sample support. Widely used in sensitive skincare raw material and wound healing research.


      Company Profile


    We are a high-tech enterprise dedicated to the research and development of innovative peptide compounds, customized synthesis and supply of scientific research raw materials. We are deeply involved in the fields of peptide chemical synthesis, purification processes and quality analysis, providing high-quality peptide research raw materials and technical support services to domestic and foreign university laboratories, pharmaceutical research institutions and CRO enterprises.
    The company has gathered professional technical teams specializing in peptide synthesis, analysis and testing, and process development. It has established a complete peptide synthesis laboratory, purification platform and quality control testing system, and possesses the capacity for large-scale preparation of long-chain peptides, modified peptides and novel target peptides. It can provide integrated technical support including solid-phase synthesis, liquid-phase synthesis, chromatographic purification, structural characterization and stability research.
    The core scientific research raw material product line covers GLP-1-related target peptides and various innovative active peptide intermediates, among which Retatrutide (LY3437943) is a scientific research grade peptide raw material. All products are for in vitro scientific research and experimental use only. They must not be used for human trials, clinical drug administration, medical aesthetics or any diagnostic or therapeutic purposes.
    The company has established a standardized quality control process. Each batch of raw materials is accompanied by HPLC purity testing and MS mass spectrometry structure verification reports, strictly controlling key indicators such as purity, impurities, and moisture. We can provide services such as repackaging in different specifications, customized synthesis, and process optimization, supporting the experimental needs of research institutions for the early-stage pharmacological research and mechanism exploration of new drug targets.
    Since its establishment, the enterprise has adhered to the concept of compliant operation, strictly abided by relevant laws and regulations on pharmaceutical research and development, and established long-term and stable cooperation with many domestic universities and drug research and development laboratories. With stable product quality, efficient delivery capabilities and professional technical consulting services, we support the basic research of innovative metabolic target drugs and continuously provide reliable raw material support for global peptide basic scientific research.


    Business philosophy


    Focus on the innovative research and development of peptides, strictly adhere to the boundaries of scientific research and application, prioritize quality, and achieve win-win results through integrity

    Contact information





    Email: 1060575270@qq.com

    W hatsapp:+852 5976 3637


      Product display 


    Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 1 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 2 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 3 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 4 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 5 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 6 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 7 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 8 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 9 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 10  Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 11 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 12 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 13 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 14 Shop LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-63-6-Detailed Image 15


    Certificates
    • LL-37 Peptide Raw Material Antimicrobial Host Defense Peptide CAS 154947-66-7 Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides,Semagiutide,Retatrutide,GHK-CU,MOTS-c,Semax

    Location:

    Units 1503-14, 15th Floor, New HNA Building, No. 7 Guoxing Avenue, Lantian Subdistrict, Meilan District, Haikou City, Hainan Province

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    3

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    101-200

    Year of Establishment:

    2025

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.