Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Antidementia Agents > LL-37 for Sale > Manufacturer's price 5-amino- SK10 SuperHumanBlend Pineal ML10 cagrilin 5mg+Samaglutide5mg
Manufacturer's price 5-amino-  SK10  SuperHumanBlend  Pineal  ML10  cagrilin 5mg+Samaglutide5mg buy - large image1
Manufacturer's price 5-amino-  SK10  SuperHumanBlend  Pineal  ML10  cagrilin 5mg+Samaglutide5mg buy - image1
Manufacturer's price 5-amino-  SK10  SuperHumanBlend  Pineal  ML10  cagrilin 5mg+Samaglutide5mg buy - image2
Manufacturer's price 5-amino-  SK10  SuperHumanBlend  Pineal  ML10  cagrilin 5mg+Samaglutide5mg buy - image3
Manufacturer's price 5-amino-  SK10  SuperHumanBlend  Pineal  ML10  cagrilin 5mg+Samaglutide5mg buy - image4
Manufacturer's price 5-amino-  SK10  SuperHumanBlend  Pineal  ML10  cagrilin 5mg+Samaglutide5mg buy - image5
Manufacturer's price 5-amino-  SK10  SuperHumanBlend  Pineal  ML10  cagrilin 5mg+Samaglutide5mg buy - image6

Manufacturer's price 5-amino- SK10 SuperHumanBlend Pineal ML10 cagrilin 5mg+Samaglutide5mg

TDS 3 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

SHENZHEN

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2026-12-15

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Business Manager: Anne
    WhatsApp: +852 6462 7346

    Items Specifications






    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 1

    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 2

    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.

    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 3

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 4

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 5
    We are a professional peptide supplier, offering four key advantages: high-purity products, efficient and safe global logistics, flexible and convenient payment methods, and a professional and dedicated team - all of which are designed to help your business reach a higher level.
    We collaborate with numerous leading logistics companies worldwide. Our global transportation network guarantees that our safe and efficient logistics services can meet your urgent needs.
    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 6

    Peptide-based products possess diverse functional advantages in various application scenarios:
    In the field of health management, peptides support metabolic regulation (helping specific groups control blood sugar and maintain a healthy weight) and immune system regulation, enhancing the body's defense response;
    In the field of skin care, peptides can promote the repair of the skin barrier, stimulate the synthesis of collagen to reduce fine lines, and improve the moisture and elasticity of the skin.
    In sports nutrition, peptide substances help with muscle recovery by reducing post-exercise tissue damage and promoting muscle protein synthesis.



    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 7

    The importance of peptides:

    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 8

    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 9

    Shop fast delivery SM10  CGL5  WA10  PI10  TB Thymosin  Acetate  DS5  ET50  SM2-Detailed Image 10

    ECHEMI Editorial Reference
    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

    Certificates
    • Manufacturer's price 5-amino-  SK10  SuperHumanBlend  Pineal  ML10  cagrilin 5mg+Samaglutide5mg Certificates 1 TDS

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Antidementia Agents

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.