Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Lyophilized Powder | hign quality
Lyophilized Powder | hign quality buy - large image1
Lyophilized Powder | hign quality buy - image1
Lyophilized Powder | hign quality buy - image2
Lyophilized Powder | hign quality buy - image3
Lyophilized Powder | hign quality buy - image4
Lyophilized Powder | hign quality buy - image5
Lyophilized Powder | hign quality buy - image6

Lyophilized Powder | hign quality

3 Inquiries

Unit Price:

$5/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical

Content:

99%

Port:

HongKong

Packaging:

10mg/vial

Price valid (until):

2026-11-02

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


    Contact us

    Name :Serena

    Whatsapp/wechat:+85270949876

    Email:serenahuatai@hotmail.com

    Product Detail   



    Here is an English product overvied for  LL37  :

    Composition:
    LL-37 is a synthetic cationic antimicrobial peptide corresponding to the C-terminal 37‑amino‑acid cleavage product of human cathelicidin hCAP18, with the sequence [LL-37, 37 aa] (molecular formula C₁₉₈H₃₆₈N₆₆O₅₃, MW ≈ 4493 Da); it is produced by solid‑phase peptide synthesis or recombinant expression systems and supplied as a high‑purity lyophilized powder for laboratory research.

    Mechanism of Action:
    It exerts broad-spectrum antimicrobial activity primarily through electrostatic interaction with negatively charged microbial membranes—particularly those of Gram‑negative and Gram‑positive bacteria, certain fungi, and enveloped viruses—followed by peptide insertion, pore formation (via carpet or toroidal-pore models), and membrane depolarization leading to cytoplasmic leakage. In addition to direct microbicidal effects, LL-37 functions as a host-defense immunomodulator by binding to and signaling through formyl peptide receptor‑like 1 (FPRL1/ALX) and P2X₇ receptors on neutrophils, monocytes, and epithelial cells, thereby promoting chemotaxis, cytokine secretion (e.g., IL‑1β, TNF‑α), wound‑healing–associated angiogenesis, and resolution of inflammation.

    Research Advantages:
    Unlike conventional antibiotics, LL-37 acts on conserved membrane lipid components rather than specific microbial enzymes or ribosomes, making it a valuable model for studying mechanisms of antibiotic resistance avoidance and innate immune activation. Its dual role—simultaneous antimicrobial action and immunomodulatory signaling—allows researchers to investigate multicellular innate responses, epithelial barrier function, and peptide‑mediated modulation of TLR signaling and autophagy in a single system; it also demonstrates measurable activity in serum‑containing media at micromolar concentrations and is amenable to site‑directed analog design for structure–activity relationship studies.

    Intended Research Population:
    This compound is designated for in vitro and non‑clinical ex vivo studies involving antimicrobial peptide mechanisms, host‑defense immunology, epithelial barrier models (skin, airway, gut), wound‑healing assays, sepsis‑related cytokine storm models, and autoimmune conditions such as psoriasis where cathelicidin dysregulation is implicated; it remains an investigational reagent restricted to scientific laboratory use and is not approved for therapeutic, diagnostic, or human/animal administration outside controlled experimental protocols.

    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 1



    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 2 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 3 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 4 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 5 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 6




    Basic Info



       Items Specifications
    Product  Name
    LL37
    CAS number 154947-66-7
    Purity 99%
    Appearance White or almost white powder
    Storage Dry and Cool Place

    Grade Standard

    Top Quality

    Grade Pharmaceutical Grade
    Specification 5mg 10mg 20mg


      Our Company  


    Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements


    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 7

    Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 2 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 3 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 4 Shop GHK-CU High quality high purity GHK-CU CAS 89030-95-5 Copper tripeptide for Long-Lasting Skin  Hot-selling-Detailed Image 5 Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 12


      Why choose us  


    Our Advantages:

    1.High quality with competitive price.

    2. All purity>99%.

    3. We are manufacturer and can provide high quality products with factory price.

    Fast and safe delivery.

    1. Parcel can be sent out in 24 hours after payment tracking number available.

    2. Secure and discreet shipment verious transportation methods for your choice.

    3. Customs pass rate >99%.

    We have clients throughout the world.

    1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.

    3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 13

    Shop ronchogen High Quality China Factory Supply Peptides Powder Bronchogen for Scientific Research-Detailed Image 14


      FAQ   


    1. How to make an order?
    Send me message and let me know what you need with quantity , then i will calculate to you

    2. What's the lead time and shipping ways?
    We will delivery to the package by UPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

    3. How do i keep the peptides when i receive it ?
    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    4. What's the payment methods?
    We could accept pay through Wise, Bank Transfer, Alipay,Alibaba USDT and BTC.


    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Lyophilized Powder | hign quality is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

    Location:

    1502A1, Building 4, Xinyuanxin Center, No. 3 Huaxin Road, Dongfeng Street, Licheng District, Jinan City, Shandong Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    1

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    51-100

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA

    COMPANY INTRODUCTION

    20 years of dedicated work in the peptide industry

    15 Years of Industry Experience

    We have been a high-tech company focused on the development, production, and marketing of various peptide products

     for 15 years. Through advanced laboratories and strict quality control, our internationally certified products are safe and 

    effective.


    Clients in Europe, the USA, Southeast Asia, and the Middle East

    As a global trading company, we serve clients across Europe, the USA, Southeast Asia, the Middle East, and beyond, providing

     customized solutions. Committed to "technology leading Health", we aim to innovate and deliver high-quality health products 

    worldwide.


    3,000sqm Factory with 60 Employees

    We have a factory covering 3,000 square meters and housing 60 employees to guarantee the highest quality all the time. We hired 

    three quality auditors with three years of experience. They meticulously inspect each item at every production stage.


    Contact Us Now

    Our products are exported to more than 130 countries and regions, which can be delivered fast within 5-14 days. We can provide

     OEM/ODM support to our customers. We have 10 professional after-sales staff to make 24-hour responses to our customers. 

    Contact us now to learn more. We hope to establish stable and strategic long-term business relationships with domestic and 

    foreign suppliers and customers, jointly pursuing a better future.


  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.