Lab Grade LL-37 Antimicrobial Peptide CAS No 154947-66-7 Consistent Pure Peptides Powder For Research Use
TDS 3 Inquiries
154947-66-7
Pharmaceutical Grade
99%
Hongkong
Tranmoo
5mg*10vials
2027-01-09
Retatrutide
-
Product Description
-
Seller Information
-
Inquiry History
-
DescriptionECHEMI Editorial ReferenceLL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.Research & Reference Note
Lab Grade LL-37 Antimicrobial Peptide CAS No 154947-66-7 Consistent Pure Peptides Powder For Research Use is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Authoritative sourcesDisclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.
Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals
CertificatesBasic Info-
Product Name:
LL-37
Other Name:Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
CAS No.:154947-66-7
Molecular Formula:C205H340N60O53
InChIKeys:POIUWJQBRNEFGX-XAMSXPGMSA-N
Molecular Weight:0
EC Number:211-519-9
Color/Form:White to off-white
Categories:
Characteristics-
Water Solubility:
Soluble to 1 mg/ml in water
-
-
Seller Information
-
Business Type:
Trader
-
Main Products:
Retatrutide
-
Location:
shenzhenshilonggangqulongchengjiedaohuanggekengshequjiazhaoyeshidaidasha902
-
Average lead Time:
15 days
-
Year of Establishment:
2024
-
-
Inquiry History3 Inquiries
Country Product Purchase Quantity Date Posted
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL 37
1 Aug 6, 2026
Indonesia
LL-37
5 MG Jun 23, 2026 Post an enquiry for this product
More from this Seller
-
-
-
Lab Grade GLP-1 Peptide CAS No 2381089-83-2 Consistent Pure Peptides Powder For Research Use
Pharmaceutical Grade / 99%
$10/G FOB
-
-
-
-
Full Technical Document SNAP-8 Supplier Supply HPLC MS COA TDS For Customer Registration Works CAS 868844-74-0
Pharmaceutical Grade / 99%
$8/G FOB
-
-
-
-
Lab Grade EPO Erythropoietin CAS No 142443-98-9 Consistent Pure Peptides Powder For Research Use
Pharmaceutical Grade / 99%
$10/G FOB
-
-
-
-
Consistent Pure Kisspeptin-10 CAS No 374675-21-5 High Purity Peptides Powder For Scientific Research
Pharmaceutical Grade / 99%
$10/G FOB
-
-
-
-
Consistent Pure IGF-1 LR3 CAS No 946870-92-4 High Purity Peptides Powder For Scientific Research
Pharmaceutical Grade / 99%
$10/G FOB
-
-
-
-
Lab Grade Cerebrolysin CAS No 12656-61-0 Consistent Pure Peptides Powder For Scientific Research Use
Pharmaceutical Grade / 99%
$10/G FOB
-
