 Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37/ 99% Purity/ 5mg 375/

LL37/ 99% Purity/ 5mg 375/ buy - large image1

LL37/ 99% Purity/ 5mg 375/

Name: LL37/ 99% Purity/ 5mg 375/
Brand: HUATAI
SKU: pr2608052866
Price: 78 USD
Availability: InStock

3 Inquiries

Unit Price:

$78/UNIT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

HUATAI

Packaging:

10 vials/kit

Price valid (until):

2026-11-03

Contact Supplier

 Chat Now

HUATAI PEPTIDES

Company Type:

Trader

Location:

China

Qualification:

Main Products:

Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Contact us

Add to WhatsApp: +85244962136 Amy

I will provide you with more comprehensive information, and I look forward to cooperating with you.

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 1

Product Detail

Composition:

LL-37 is a synthetic cationic antimicrobial peptide corresponding to the C-terminal 37‑amino‑acid cleavage product of human cathelicidin hCAP18, with the sequence [LL-37, 37 aa] (molecular formula C₁₉₈H₃₆₈N₆₆O₅₃, MW ≈ 4493 Da); it is produced by solid‑phase peptide synthesis or recombinant expression systems and supplied as a high‑purity lyophilized powder for laboratory research.

Mechanism of Action:

It exerts broad-spectrum antimicrobial activity primarily through electrostatic interaction with negatively charged microbial membranes—particularly those of Gram‑negative and Gram‑positive bacteria, certain fungi, and enveloped viruses—followed by peptide insertion, pore formation (via carpet or toroidal-pore models), and membrane depolarization leading to cytoplasmic leakage. In addition to direct microbicidal effects, LL-37 functions as a host-defense immunomodulator by binding to and signaling through formyl peptide receptor‑like 1 (FPRL1/ALX) and P2X₇ receptors on neutrophils, monocytes, and epithelial cells, thereby promoting chemotaxis, cytokine secretion (e.g., IL‑1β, TNF‑α), wound‑healing–associated angiogenesis, and resolution of inflammation.

Research Advantages:

Unlike conventional antibiotics, LL-37 acts on conserved membrane lipid components rather than specific microbial enzymes or ribosomes, making it a valuable model for studying mechanisms of antibiotic resistance avoidance and innate immune activation. Its dual role—simultaneous antimicrobial action and immunomodulatory signaling—allows researchers to investigate multicellular innate responses, epithelial barrier function, and peptide‑mediated modulation of TLR signaling and autophagy in a single system; it also demonstrates measurable activity in serum‑containing media at micromolar concentrations and is amenable to site‑directed analog design for structure–activity relationship studies.

Intended Research Population:

This compound is designated for in vitro and non‑clinical ex vivo studies involving antimicrobial peptide mechanisms, host‑defense immunology, epithelial barrier models (skin, airway, gut), wound‑healing assays, sepsis‑related cytokine storm models, and autoimmune conditions such as psoriasis where cathelicidin dysregulation is implicated; it remains an investigational reagent restricted to scientific laboratory use and is not approved for therapeutic, diagnostic, or human/animal administration outside controlled experimental protocols.

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 2

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 3

Items	Specifications
Product Name	LL37
CAS number	154947-66-7
Purity	99%
Appearance	White or almost white powder
Storage	Dry and Cool Place
Grade Standard	Top Quality
Grade	Pharmaceutical Grade
Specification	5mg

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 4

Why choose us

Our Advantages：

1.High quality with competitive price.

2. All purity>99%.

3. We are manufacturer and can provide high quality products with factory price.

Fast and safe delivery.

1. Parcel can be sent out in 24 hours after payment tracking number available.

2. Secure and discreet shipment verious transportation methods for your choice.

3. Customs pass rate >99%.

We have clients throughout the world.

1. Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

2. Market feedback and goods feedback will be appreciated, meeting customers’ requirement is our principal responsibility.

3. High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 5

FAQ

1. How to make an order?
Send me message and let me know what you need with quantity , then i will calculate to you

2. What's the lead time and shipping ways?
We will delivery to the package by UPS, FEDEX, DHL paket and YANWEN express to you after receive your payment, it would take around 5-15 days to your address.

3. How do i keep the peptides when i receive it ?
Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

4. What's the payment methods?
We could accept pay through Wise, Bank Transfer, USDT and BTC.

5.Does the product have a test report?

Each batch of our products undergoes testing before leaving the factory, and a Certificate of Analysis (COA) report is issued.

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 7

Our Company

Our company is located in Zhejiang Province and is a Chinese enterprise specializing in the production of peptide products.We are not intermediaries or resellers; we are the original manufacturer. This allows us to offer you the most competitive pricing. Our motto is: to manufacture products with care and serve customers with dedication.We are dedicated to serving every visitor with heart. No matter where you come from, you will experience our premium VIP service. We guarantee that every customer receives only the finest products, backed by exceptional after-sales support, as we strive to ensure your complete satisfaction.

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 8

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 9

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 10

Shop LL37/ 99% Purity/ 5mg 375/-Detailed Image 11

ECHEMI Editorial Reference

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Bulk Drug Intermediates

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
Tirzepatide,Retatrutide,NAD+,Samaglutide,GHK-CU,cagrilintide

Location:
1502A1, Building 4, Xinyuanxin Center, No. 3 Huaxin Road, Dongfeng Street, Licheng District, Jinan City, Shandong Province

Payment Terms:
TT against B/L draft before shipment,100% TT in advance

Average lead Time:
1

Total Annual Revenue:
$10 million-$25 million

Total Employees:
51-100

Year of Establishment:
2026

Certifications:
COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA,COA

COMPANY INTRODUCTION
20 years of dedicated work in the peptide industry
15 Years of Industry Experience
We have been a high-tech company focused on the development, production, and marketing of various peptide products
for 15 years. Through advanced laboratories and strict quality control, our internationally certified products are safe and
effective.

Clients in Europe, the USA, Southeast Asia, and the Middle East
As a global trading company, we serve clients across Europe, the USA, Southeast Asia, the Middle East, and beyond, providing
customized solutions. Committed to "technology leading Health", we aim to innovate and deliver high-quality health products
worldwide.

3,000sqm Factory with 60 Employees
We have a factory covering 3,000 square meters and housing 60 employees to guarantee the highest quality all the time. We hired
three quality auditors with three years of experience. They meticulously inspect each item at every production stage.

Contact Us Now
Our products are exported to more than 130 countries and regions, which can be delivered fast within 5-14 days. We can provide
OEM/ODM support to our customers. We have 10 professional after-sales staff to make 24-hour responses to our customers.
Contact us now to learn more. We hope to establish stable and strategic long-term business relationships with domestic and
foreign suppliers and customers, jointly pursuing a better future.

Inquiry History

3 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL 37	1	Aug 6, 2026
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37	Pharmaceutical Grade/99	$45/UNIT FOB	Haikou Mingheng	Inquiry
99% Purity LL37 Lyophilized Cosmetic Peptide Powder, 5mg 10mg Vials, US Local Warehouse	Research Grade/99		Tianjin Huifeng Technology Co., Ltd.	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry

LL37/ 99% Purity/ 5mg 375/

Product Description

Seller Information

Inquiry History

Grade Standard

Top Quality

More Choices Find All Products for Sale 

Related Searches