Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Glucagon for Sale > GND2, 99%+ purity, factory direct sales, door-to-door delivery.
GND2, 99%+ purity, factory direct sales, door-to-door delivery. buy - large image1
GND2, 99%+ purity, factory direct sales, door-to-door delivery. buy - image1
GND2, 99%+ purity, factory direct sales, door-to-door delivery. buy - image2
GND2, 99%+ purity, factory direct sales, door-to-door delivery. buy - image3
GND2, 99%+ purity, factory direct sales, door-to-door delivery. buy - image4
GND2, 99%+ purity, factory direct sales, door-to-door delivery. buy - image5
GND2, 99%+ purity, factory direct sales, door-to-door delivery. buy - image6

GND2, 99%+ purity, factory direct sales, door-to-door delivery.

4 Inquiries

Unit Price:

$32/UNIT FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

High Purity Grade

Content:

99%

Port:

Shenzhen

Brand:

Custom

Packaging:

Aseptic sealed vials, 2mg/kit

Price valid (until):

2026-09-05

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      GND2  supplied as white lyophilized powder for laboratory‑only research. Manufactured via solid‑phase peptide‑synthesis technique. Every‑batch HPLC detection guarantees stable purity and consistent‑batch quality. Vacuum freeze‑dried treatment stabilizes molecular‑structure, the lyophilized‑powder owns favourable water‑solubility for laboratory preparation. Each vial adopts vacuum‑sealed packaging to isolate moisture, air‑oxidation. We maintain adequate spot‑inventory and support fast‑outbound delivery. Batch‑matched COA inspection‑report is available. Only applied to in‑vitro scientific‑exploration. Not permitted for human‑administration, clinical‑therapy or sports‑related usage.  


    Our Factory & Production Advantages

    1. We adopt ISO international cleanroom grading standards for the whole production area. Key procedures including purification, freeze-drying and vial filling are completed in independent constant-temperature & constant-humidity clean zones.

      Strict air purification, particle and microbial monitoring are operated all day long; separate functional areas are divided to effectively avoid cross-contamination between different peptide varieties, guaranteeing high cleanliness of finished powder products.
    2. Professional Lyophilization Freeze-drying Production Line

      Equipped with large-scale industrial vacuum freeze-drying equipment. The low-temperature vacuum lyophilization technology can well lock molecular activity, prevent powder degradation, moisture absorption and discoloration.

      All finished products are white uniform powder with stable properties and long shelf life under standard storage conditions.
    3. Full Strict Quality Control System

      The whole production process follows standardized operational specifications. Raw material incoming inspection, intermediate testing and finished product delivery inspection are carried out step by step.

      Every batch of raw materials will be tested by independent third-party professional laboratories via HPLC and FTIR methods. We will provide the official raw material COA certificate along with each shipment.

    4. Complete Supporting Production Equipment

      Full set of peptide synthesis, chromatographic purification, centrifugal concentration and sealed filling equipment. All instruments are regularly calibrated to ensure accurate content proportion, consistent purity and batch-to-batch quality stability.
    5. Independent R&D & Flexible Production Capacity

      Own professional peptide R&D laboratory team, can stably produce dozens of mainstream polypeptide varieties. Support small batch trial orders and large-volume bulk wholesale, flexible to meet different order demands.
    6. Standard Sealed Packaging & Perfect Storage Protection

      Adopt sterile borosilicate glass vials with vacuum crimp sealing. The sealed structure isolates air and moisture, effectively protecting powder activity during transportation and storage.
    Items Specifications
    Product Name GND2
    Physical Appearance White Lyophilized Powder
    Content Per Vial 2mg vial
    Purity ≥98% (Tested by HPLC)
    Solubility Freely soluble in sterile water
    Package Specification 10 vials per carton box
    Selling Rule Only whole boxes available, single vial not sold
    Short-term Storage 2℃ ~ 8℃ refrigeration, sealed and protected from light
    Long-term Storage Solely for laboratory scientific research
    Qualification Document
    COA provided per batch

    Shop Gonadorelin Acetate, factory direct sales, door-to-door delivery.-Detailed Image 1
    Shop Gonadorelin Acetate, factory direct sales, door-to-door delivery.-Detailed Image 2
    Shop Gonadorelin Acetate, factory direct sales, door-to-door delivery.-Detailed Image 3
    Shop Gonadorelin Acetate, factory direct sales, door-to-door delivery.-Detailed Image 4
    Shop Gonadorelin Acetate, factory direct sales, door-to-door delivery.-Detailed Image 5
    Shop Gonadorelin Acetate, factory direct sales, door-to-door delivery.-Detailed Image 6
    ECHEMI Editorial Reference
    White or almost white powderProduced by the α cells of the islands of Langerhans and also by the gastric mucosa. It is opposite in effect to insulin. It appears to be a straight-chain polypeptide with a molecular weight of approximately 3500. Small amounts have been detected in commproduced by recombinant DNA technology ismarketed by Novo Nordisk (glucagon [recombinant] hydrochloride,GlucaGen HypoKit, GlucaGen Diagnostic Kit)and by Eli Lilly (glucagon [recombinant] Emergency Kit). The hypergly

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Categories:

    Polypeptide

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide

    Location:

    Licheng District, Jinan City, Shandong Province

    Payment Terms:

    100% TT in advance

    Average lead Time:

    14

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Certifications:

    Retatrutide coa

    Hello and welcome to learn about Kangshengda Biotechnology! We are a specialized enterprise dedicated to the R&D and production of peptide products. Leveraging high-quality peptide preparations, our core strength lies in supporting customers to achieve long-term weight management and all-round health regulation.
    Boasting extensive mature export experience, our products are sold to Europe, the United States and numerous other countries and regions worldwide. Supported by consistent, reliable product quality, efficient on-time delivery and a comprehensive professional after-sales service system, we have built long-term, solid strategic partnerships with overseas distributors.
    We are committed to delivering one-stop customized premium peptide solutions for all clients, and seek long-term development and win-win cooperation alongside domestic and global partners!
    KSD
    ">KSD
  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.