Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D
Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D buy - large image1
Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D buy - image1
Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D buy - image2
Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D buy - image3
Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D buy - image4
Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D buy - image5
Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D buy - image6

Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D

TDS 3 Inquiries

Unit Price:

$580-650/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

Hangzhou

Brand:

HyperChem

Packaging:

1kg/bag, 5kg/bag, 25kg/Drum

Price valid (until):

2028-02-29

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Pharmaceuticals,Peptide,Cosmetics,Nutritional Supplements

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Name

    Lithium Orotate


    CAS number

    5266-20-6


    Synonym

    Lithium orotate
    5266-20-6
    Orotic acid lithium salt monohydrate
    lithium 2,6-dioxo-1,2,3,6-tetrahydropyrimidine-4-carboxylate
    lithium;2,4-dioxo-1H-pyrimidine-6-carboxylate
    L2N7Z24B30
    4-Pyrimidinecarboxylic acid, 1,2,3,6-tetrahydro-2,6-dioxo-, monolithium salt
    4-Pyrimidinecarboxylic acid, 1,2,3,6-tetrahydro-2,6-dioxo-, lithium salt (1:1)


    Related APIs #

    Calcium Orotate (CAS: 22454-86-0)
    Potassium Orotate (CAS:24598-73-0)
    Magnesium Orotate (CAS:34717-03-8)
    Zinc Orotate (CAS:68399-76-8)


    Description

    What is Lithium Orotate?
    Lithium orotate is a compound that combines lithium, a naturally occurring mineral, with orotic acid. Unlike prescription lithium carbonate, which is often used for treating bipolar disorder, lithium orotate is available over the counter and is believed to have higher bioavailability, allowing for effective lower doses.

    Applications of Lithium Orotate


    1. Mood Regulation
    Lithium orotate is primarily recognized for its mood-stabilizing properties. It may help regulate neurotransmitter activity in the brain, potentially alleviating symptoms of depression and anxiety. Users often report improved emotional stability and a sense of calmness after incorporating it into their routines12.


    2. Cognitive Support
    Emerging research indicates that lithium may enhance cognitive functions such as memory and focus. Some individuals use lithium orotate as a nootropic to support mental clarity. Studies suggest that it promotes neurogenesis, which is the growth of new neurons, thereby contributing to improved cognitive health.

    3. Neuroprotective Effects
    Lithium has been studied for its neuroprotective properties, which may help shield brain cells from damage associated with neurodegenerative diseases like Alzheimer's and Parkinson's. This protective effect could be beneficial in preserving cognitive function as one ages.

    4. Stress Reduction
    By modulating neurotransmitter levels, lithium orotate may assist in managing stress and promoting resilience against daily challenges. This can lead to an overall improvement in mental well-being.

    5. Alcoholism Treatment
    Research has indicated that lithium orotate may aid in alcohol rehabilitation. In clinical studies, patients treated with lithium orotate showed reduced relapse rates during recovery from alcoholism.

    6. Potential Longevity Benefits
    Some researchers speculate that lithium's ability to reduce inflammation and modulate cellular processes could contribute to longevity and overall health. However, more research is needed to substantiate these claims12.
    Dosage and Safety Considerations
    The typical dosage for lithium orotate ranges from 5 mg taken two to three times daily. This lower dosage is generally associated with fewer side effects compared to higher doses of prescription lithium medications24. However, individuals should consult healthcare professionals before starting supplementation, especially if they have existing health conditions or are taking other medications that affect the kidneys or serotonin levels35.

    Conclusion
    Lithium orotate presents a promising option for those seeking natural support for mood stabilization, cognitive enhancement, and stress management. While anecdotal evidence and preliminary studies suggest various benefits, further research is necessary to fully understand its efficacy and safety profile in different populations.


    Molecular Formula

    C5H3LiN2O4

    Molecular Weight

    162.1 g/mol

    Appearance

    White or almost white powder

    Quality Standard

    Enterprise standard; 98%- 102%(ICP-AES)

    Shipping Condition

    Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition

    Dry, dark and at 0-28 for short term (days to weeks) or 8-20 for long term (months to years).

    Shelf Life

    >2 years if stored properly

    Sample package

    Double plastic bags inside, fiber drum outside, any quantity available.

    Commercial package

    Aluminium Tin, Fiber drum

    Origin

    China


    Product Image

    Shop USP Quality Standard API Finasteride Powder with CAS 98319-26-7-Detailed Image 2

    Shop USP Quality Standard API Finasteride Powder with CAS 98319-26-7-Detailed Image 3



    FAQ

    Q1. What is the Hyper chem payment term?
    T/T advance
    LC at sight
    DP at sight
    Trade assurance 
    Money gram 


    Q2. What is Hyper chem shipment policy?
    Our policy is to strive for the quickest shipment time possible, with ready stock sample shipment typically going out the same day that your order was placed. Your satisfaction is very important to us.
    For non-ready stock, please contact the Hyper Chem sales team to negotiate.

     

    Q3. What hyper chem will provide after shipment?
    For sample orders: 
    After shipment is done, an timely email including:

    Track details (Fedex /TNT/DHL/EMS Track number)

    Package photo

    COA, MSDS, etc 

    Dispatch date & Estimated arriving time

    Shipping invoice

    For commercial orders
    A full set of shipment documents as well as package photos can be provided
    in scan-copy and original, to help customers complete the customs clearance process.

     

    Q4. What is Hyper Chem shipment term?

               By Express   
    DHL  FedEx  TNT  EMS                               
    Fast:5 days around                             
    High cost, door to door service

               By Air                                        
    Suitable for more than 50kg 
    Fast :3-7 days Hight cost, port to port, professional broker needed 

               By Sea
    Suitable for more than 500kg      
    Slow:7-45 days, Low cost, port to port, professional broker needed 
    We will always attempt to utilize the quickest and most affordable way for customers to receive orders. And follow -up with customers via email for all shipment details as well as updated track information until it arrives without damage.

     

    Q5. Does hyper chem provide a shipment return policy?
    Yes, we have.
    Return Policy:  At Hyper chem, your satisfaction is guaranteed. If you are dissatisfied for any reason with a product, please send back the unused portion along with your packing slip and a brief note on why you were dissatisfied  within 45 days of purchase for a full refund to:

     

    Q6. What is hyper chem After-sales service
    •Documents support: COA ,MSDS, MOA ,MS Report,HNMR Report,SDS,DMF
    • Customer Support: Shipment clearance support, quality issue support
    • Automated Customer Service: Our worldwide customers enjoy immediate 24/7 access to the HYPER CHEM support team from any location, at any time.

     

     

     

    Company profile

    Established in 2013, Hyper Chem has exclusive tie-ups with leading manufacturers, supplying raw materials produced in GMP and ISO 9002 certified facilities, and provides high-quality ingredients and raw materials to cater to the requirements of our diverse range of clients.

     

    Among them, our key client industrial sectors around the global are:

     

    Pharmaceuticals
    Nutrition Ingredients/ Dietary supplements
    Cosmetic Ingredients
    Food Ingredients
    Veterinary API
    Agriculture fertilizer
    Custom Synthesis lab supply

     

    HyperChem provides to its wonderful and honorable clients comprehensive purchasing and distribution services which ensure that we are delivering the right generic, raw, or customized product, make sure that we are delivering it at the right time, ensure that it is delivered in the specified amount, and in the right kind of packaging to clients and customers of all types of industries irrespective of their size of operation.


    LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
    Research & Reference Note

    Pharmaceutical Peptide LL-37 CAS:154947-66-7 for R&D is listed on ECHEMI for industrial / laboratory sourcing. This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Disclaimer: This listing is for industrial and laboratory research use. Product information on ECHEMI is provided for sourcing and specification reference. It is not medical advice, a clinical recommendation, or an approved therapy description. Always verify regulatory status, purity, and intended use with the supplier and applicable authorities before purchase or use.

    Reviewed by ECHEMI Scientific Review - Platform editorial review for research chemicals

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Pharmaceuticals,Peptide,Cosmetics,Nutritional Supplements

    Location:

    Rm. 803, Tower 4, LOFT49 Creative City Pioneer Zone, No.88 Jiru Rd. Gongshu Dist., Hangzhou, 310015 ZJ, China

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    10

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2013

    Certifications:

    Certification Report by Bureau Veritas

    About HyperChem

    Established in 2013, Hyper Chem has exclusive tie-ups with leading manufacturers, supplying raw materials produced in GMP and ISO 9002 certified facilities, and provides high-quality ingredients and raw materials to meet the needs of a diverse range of pharmaceutical cosmetics ingredients and nootropic supplements companies worldwide.

    Our Competitiveness

    One-stop supply

    Wide Range Of products including pharmaceutical, Cosmetic Ingredients and nootropic supplements

    Among all the pharmaceuticals,

    90% of them with GMP certificates,

    85% of them with DMF files and

    50% of them passed FDA approval,

    30% get CEP certificate

    20% are new R&D products.

    Custom Repackaging Service


    We can efficiently repackage your material into sample sizes, custom batch-specific sizes, or semi-bulk package sizes according to your specifications. And ensures the product is packaged in a quality-controlled environment and will maintain its integrity throughout every stage of the process.

    Quality Control/Quality Assurance


    HyperChem is committed to delivering on its promises of top-quality products with verified quality data.

    All materials are vigorously inspected by the factory and/or outsourced analytical laboratories to ensure each and every lot meets or exceeds our reference standards.

    Trade assurance service with 100% payment protection, It is best achieved by delivering products and services 100% right the first time, on time, every time.

    Professional

    Transparent Communication

    Fast Reaction,

    Professional Suggestion

    Beyond Expectation.

    We have exclusive partnerships with research and production facilities across the country and we offer varied pharmaceutical services in the most cost-efficient way. The production facilities are GMP, WHO-GMP, EU GMP and US FDA approved and are backed by strong regulatory support such as Dossier, DMF, Tech Pack and relevant Stability studies for regulatory filings.

  • Inquiry History
    3 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL 37

    Aug 6, 2026
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.